Recombinant Human RPS23 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RPS23 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 44-143 of Human RPS23 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:ASHAKGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCLNFIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKGKKERPRS

Protein/Peptide Type
Partial Recombinant Protein
Gene
RPS23

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RPS23 Protein

  • FLJ35016
  • homolog of yeast ribosomal protein S28
  • ribosomal protein S23,40S ribosomal protein S23

Background

RPS23 - ribosomal protein S23

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92352
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-80803
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-33691
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01808
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
H00006201-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-87797
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-20228
Species: Hu, Ze
Applications: WB
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP2-37620
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
H00006223-M01
Species: Hu
Applications: WB, ELISA
NB100-345
Species: Hu
Applications: WB, ChIP, IP
NBP1-80959
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006192-P01
Species: Hu
NBP1-82761
Species: Hu
Applications: IHC, IHC-P
NB100-1103
Species: Hu
Applications: WB, PEP-ELISA
NBP2-22298
Species: Hu, Mu
Applications: IP (-), WB, IHC-P
NBP1-80804
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for RPS23 Partial Recombinant Protein (H00006228-Q01) (0)

There are no publications for RPS23 Partial Recombinant Protein (H00006228-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPS23 Partial Recombinant Protein (H00006228-Q01) (0)

There are no reviews for RPS23 Partial Recombinant Protein (H00006228-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RPS23 Partial Recombinant Protein (H00006228-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RPS23 Products

Bioinformatics Tool for RPS23 Partial Recombinant Protein (H00006228-Q01)

Discover related pathways, diseases and genes to RPS23 Partial Recombinant Protein (H00006228-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RPS23 Partial Recombinant Protein (H00006228-Q01)

Discover more about diseases related to RPS23 Partial Recombinant Protein (H00006228-Q01).
 

Pathways for RPS23 Partial Recombinant Protein (H00006228-Q01)

View related products by pathway.

PTMs for RPS23 Partial Recombinant Protein (H00006228-Q01)

Learn more about PTMs related to RPS23 Partial Recombinant Protein (H00006228-Q01).
 

Research Areas for RPS23 Partial Recombinant Protein (H00006228-Q01)

Find related products by research area.

Blogs on RPS23

There are no specific blogs for RPS23, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CD20 Antibody (AISB12)
NBP1-43435-0.1mg
RPS23 Antibody (1E3.)
H00006228-M02

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RPS23 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RPS23