RPESP Antibody

Images

 
Western Blot: RPESP Antibody [NBP1-70697] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RPESP Antibody Summary

Immunogen
Synthetic peptides corresponding to RPESP(RPE-spondin) The peptide sequence was selected from the C terminal of RPESP. Peptide sequence WMQYLREGYTVCVDCQPPAMNSVSLRCSGDGLDSDGNQTLHWQAIGNPRC.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SBSPON
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against RPESP and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RPESP Antibody

  • chromosome 8 open reading frame 84

Background

RPESP belongs to the thrombospondin family. It contains 1 SMB (somatomedin-B) domain and 1 TSP type-1 domain. The exact function of RPESP remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB3428
Species: Hu
Applications: WB, IHC
NBP1-86286
Species: Hu
Applications: WB, IHC, IHC-P
AF842
Species: Hu
Applications: WB
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RPESP Antibody (NBP1-70697) (0)

There are no publications for RPESP Antibody (NBP1-70697).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RPESP Antibody (NBP1-70697) (0)

There are no reviews for RPESP Antibody (NBP1-70697). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RPESP Antibody (NBP1-70697) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RPESP Products

RPESP NBP1-70697

Bioinformatics Tool for RPESP Antibody (NBP1-70697)

Discover related pathways, diseases and genes to RPESP Antibody (NBP1-70697). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on RPESP

There are no specific blogs for RPESP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RPESP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SBSPON