![Immunocytochemistry/Immunofluorescence: RNF220 Antibody (5E5) [H00055182-M01] - Analysis of monoclonal antibody to RNF220 on HeLa cell . Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize/RNF220-Antibody-5E5-Immunocytochemistry-Immunofluorescence-H00055182-M01-img0003.jpg "Immunocytochemistry/Immunofluorescence: RNF220 Antibody (5E5) [H00055182-M01] - Analysis of monoclonal antibody to RNF220 on HeLa cell . Antibody concentration 10 ug/ml.")
| Reactivity | HuSpecies Glossary |
| Applications | ELISA, ICC/IF |
| Clone | 5E5 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Mouse RNF220 Antibody (5E5) - Azide and BSA Free (H00055182-M01) is a monoclonal antibody validated for use in ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | FLJ10597 (NP_060620, 468 a.a. ~ 566 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QEAMQKTCKNSDIEKITEDSAVTTFEALKARVRELERQLSRGDRYKCLICMDSYSMPLTSIQCWHVHCEECWLRTLGAKKLCPQCNTITAPGDLRRIYL |
| Specificity | C1orf164 - hypothetical protein FLJ10597 |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | RNF220 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against recombinant protein on ELISA. GST alone used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Sandwich ELISA: RNF220 Antibody (5E5) [H00055182-M01] - Detection limit for recombinant GST tagged C1orf164 is approximately 0.03ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/RNF220-Antibody-5E5-Sandwich-ELISA-H00055182-M01-img0004.jpg "Sandwich ELISA: RNF220 Antibody (5E5) [H00055182-M01] - Detection limit for recombinant GST tagged C1orf164 is approximately 0.03ng/ml as a capture antibody.")
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")