RNF180 Antibody

Images

 
Immunohistochemistry-Paraffin: RNF180 Antibody [NBP1-86127] - Staining of human thyroid gland shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RNF180 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EKLTLLPTLYEIHSKTTAYSRLNETQPIDLSGLPLQSSKNSYSFQNPSSFDPSMLLQRFSVAPHETQTQRGGEFQCGLEAASVYSDHTNTNNLTFLMDLPSAGRSMPEASDQEEHLSPLDFLHSAN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RNF180
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RNF180 Protein (NBP1-86127PEP)
Publications
Read Publication using NBP1-86127.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RNF180 Antibody

  • E3 ubiquitin-protein ligase RNF180
  • EC 6.3.2.-
  • MGC120328
  • ring finger protein 180MGC120326

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-21590
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-52414
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready, ICC, IF
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-24716
Species: Hu, Pm
Applications: WB, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-78983
Species: Hu, Mu
Applications: WB (-), ICC/IF, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P

Publications for RNF180 Antibody (NBP1-86127)(1)

Reviews for RNF180 Antibody (NBP1-86127) (0)

There are no reviews for RNF180 Antibody (NBP1-86127). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RNF180 Antibody (NBP1-86127) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RNF180 Products

Bioinformatics Tool for RNF180 Antibody (NBP1-86127)

Discover related pathways, diseases and genes to RNF180 Antibody (NBP1-86127). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNF180 Antibody (NBP1-86127)

Discover more about diseases related to RNF180 Antibody (NBP1-86127).
 

Pathways for RNF180 Antibody (NBP1-86127)

View related products by pathway.

PTMs for RNF180 Antibody (NBP1-86127)

Learn more about PTMs related to RNF180 Antibody (NBP1-86127).
 

Research Areas for RNF180 Antibody (NBP1-86127)

Find related products by research area.

Blogs on RNF180

There are no specific blogs for RNF180, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RNF180 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF180