RNF170 Antibody

Images

 
Immunohistochemistry-Paraffin: RNF170 Antibody [NBP2-31006] - Staining of human colon shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RNF170 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ENQELVRVLREQLQTEQDAPAATRQQFYTDMYCPICLHQASFPVETN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RNF170
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
RNF170 Protein (NBP2-31006PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RNF170 Antibody

  • DKFZP564A022
  • FLJ38306
  • Putative LAG1-interacting protein
  • ring finger protein 170

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88539
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88247
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83639
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90660
Species: Hu
Applications: IHC, IHC-P

Publications for RNF170 Antibody (NBP2-31006) (0)

There are no publications for RNF170 Antibody (NBP2-31006).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNF170 Antibody (NBP2-31006) (0)

There are no reviews for RNF170 Antibody (NBP2-31006). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for RNF170 Antibody (NBP2-31006) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RNF170 Products

Bioinformatics Tool for RNF170 Antibody (NBP2-31006)

Discover related pathways, diseases and genes to RNF170 Antibody (NBP2-31006). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNF170 Antibody (NBP2-31006)

Discover more about diseases related to RNF170 Antibody (NBP2-31006).
 

Pathways for RNF170 Antibody (NBP2-31006)

View related products by pathway.

PTMs for RNF170 Antibody (NBP2-31006)

Learn more about PTMs related to RNF170 Antibody (NBP2-31006).
 

Research Areas for RNF170 Antibody (NBP2-31006)

Find related products by research area.

Blogs on RNF170

There are no specific blogs for RNF170, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RNF170 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF170
Uniprot