![Western Blot: RNF166 Antibody [NBP2-94903] - Analysis of extracts of various cell lines, using RNF166 . Exposure time: 15s.](http://images.novusbio.com/fullsize/RNF166-Antibody-Western-Blot-NBP2-94903-img0005.jpg "Western Blot: RNF166 Antibody [NBP2-94903] - Analysis of extracts of various cell lines, using RNF166 . Exposure time: 15s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit RNF166 Antibody - BSA Free (NBP2-94903) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 102-201 of human RNF166 (NP_849163.1). NKKVTLAKMRVHISSCLKVQEQMANCPKFVPVVPTSQPIPSNIPNRSTFACPYCGARNLDQQELVKHCVESHRSDPNRVVCPICSAMPWGDPSYKSANFL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RNF166 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for RNF166 Antibody (NBP2-94903)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RNF166 |
![Immunohistochemistry-Paraffin: RNF166 Antibody [NBP2-94903] - Paraffin-embedded rat kidney using RNF166 .](http://images.novusbio.com/fullsize/RNF166-Antibody-Immunohistochemistry-Paraffin-NBP2-94903-img0004.jpg "Immunohistochemistry-Paraffin: RNF166 Antibody [NBP2-94903] - Paraffin-embedded rat kidney using RNF166 .")
![Immunohistochemistry-Paraffin: RNF166 Antibody [NBP2-94903] - Paraffin-embedded human liver damage using RNF166 .](http://images.novusbio.com/fullsize/RNF166-Antibody-Immunohistochemistry-Paraffin-NBP2-94903-img0001.jpg "Immunohistochemistry-Paraffin: RNF166 Antibody [NBP2-94903] - Paraffin-embedded human liver damage using RNF166 .")
![Immunohistochemistry-Paraffin: RNF166 Antibody [NBP2-94903] - Paraffin-embedded mouse brain using RNF166 .](http://images.novusbio.com/fullsize/RNF166-Antibody-Immunohistochemistry-Paraffin-NBP2-94903-img0002.jpg "Immunohistochemistry-Paraffin: RNF166 Antibody [NBP2-94903] - Paraffin-embedded mouse brain using RNF166 .")
![Immunohistochemistry-Paraffin: RNF166 Antibody [NBP2-94903] - Paraffin-embedded rat brain using RNF166 .](http://images.novusbio.com/fullsize/RNF166-Antibody-Immunohistochemistry-Paraffin-NBP2-94903-img0003.jpg "Immunohistochemistry-Paraffin: RNF166 Antibody [NBP2-94903] - Paraffin-embedded rat brain using RNF166 .")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")