RNF166 Antibody

Images

 
Western Blot: RNF166 Antibody [NBP1-80432] - Titration: 0.2-1 ug/ml, Positive Control: THP-1 cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RNF166 Antibody Summary

Immunogen
Synthetic peptide directed towards the middle region of human RNF166. Peptide sequence RVVCPICSAMPWGDPSYKSANFLQHLLHRHKFSYDTFVDYSIDEEAAFQA.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RNF166
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against RNF166 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RNF166 Antibody

  • MGC14381
  • MGC2647
  • ring finger protein 166

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83653
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-58824
Species: Hu, Mu
Applications: WB, ChIP, IP, CHIP-SEQ
H00051444-T01
Species: Hu
NB120-5802
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, ChIP, ICC
NBP1-87204
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80432
Species: Hu
Applications: WB

Publications for RNF166 Antibody (NBP1-80432) (0)

There are no publications for RNF166 Antibody (NBP1-80432).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNF166 Antibody (NBP1-80432) (0)

There are no reviews for RNF166 Antibody (NBP1-80432). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RNF166 Antibody (NBP1-80432) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for RNF166 Antibody (NBP1-80432)

Discover related pathways, diseases and genes to RNF166 Antibody (NBP1-80432). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNF166 Antibody (NBP1-80432)

Discover more about diseases related to RNF166 Antibody (NBP1-80432).
 

Pathways for RNF166 Antibody (NBP1-80432)

View related products by pathway.

PTMs for RNF166 Antibody (NBP1-80432)

Learn more about PTMs related to RNF166 Antibody (NBP1-80432).

Blogs on RNF166

There are no specific blogs for RNF166, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RNF166 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF166
Uniprot