RMND1 Antibody


Western Blot: RMND1 Antibody [NBP1-90033] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunocytochemistry/ Immunofluorescence: RMND1 Antibody [NBP1-90033] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli.
Immunohistochemistry-Paraffin: RMND1 Antibody [NBP1-90033] - Staining of human small intestine shows strong cytoplasmic and nuclear positivity in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

RMND1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LKAGKKVKLSHEEVMQKIGELFALRHRINLSSDFLITPDFYWDRENLEGLYDKTCQFLSIGRRVKVMNEKLQHCMEL
Specificity of human RMND1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RMND1 Protein (NBP1-90033PEP)
Read Publication using NBP1-90033.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23022099)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for RMND1 Antibody

  • bA351K16
  • bA351K16.3
  • C6orf96
  • chromosome 6 open reading frame 96
  • FLJ20627
  • MGC117362
  • MGC149570
  • MGC88260
  • required for meiotic nuclear division 1 homolog (S. cerevisiae)
  • required for meiotic nuclear division protein 1 homolog
  • RMD1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Eq, Op, Pm
Applications: WB, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RMND1 Antibody (NBP1-90033)(1)

Reviews for RMND1 Antibody (NBP1-90033) (0)

There are no reviews for RMND1 Antibody (NBP1-90033). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RMND1 Antibody (NBP1-90033) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional RMND1 Products

RMND1 NBP1-90033

Bioinformatics Tool for RMND1 Antibody (NBP1-90033)

Discover related pathways, diseases and genes to RMND1 Antibody (NBP1-90033). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RMND1 Antibody (NBP1-90033)

Discover more about diseases related to RMND1 Antibody (NBP1-90033).

Pathways for RMND1 Antibody (NBP1-90033)

View related products by pathway.

PTMs for RMND1 Antibody (NBP1-90033)

Learn more about PTMs related to RMND1 Antibody (NBP1-90033).

Blogs on RMND1

There are no specific blogs for RMND1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RMND1 Antibody and receive a gift card or discount.


Gene Symbol RMND1