RGS7 Antibody

Images

 
Western Blot: RGS7 Antibody [NBP2-86776] - Host: Rabbit. Target Name: RGS7. Sample Type: Jurkat Whole cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RGS7 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human RGS7. Peptide sequence: GNNYGQTSNGVADESPNMLVYRKMEDVIARMQDEKNGIPIRTVKSFLSKI The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
RGS7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RGS7 Antibody

  • regulator of G-protein signaling 7
  • regulator of G-protein signaling RGS7
  • regulator of G-protein signalling 7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010681-M01
Species: Hu
Applications: ELISA, PLA, S-ELISA, WB
NBP1-58919
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-32728
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB100-56658
Species: Hu, Mu, Rt
Applications: WB
NBP2-94071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56659
Species: Hu, Mu, Rt
Applications: WB
NBP2-46123
Species: Hu
Applications: IF, IHC, IHC-P, WB
H00005997-M01
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, KD, WB
NBP1-32521
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
AF6880
Species: Hu
Applications: IHC, WB
NLS418
Species: Hu
Applications: IHC, IHC-P
NBP1-86020
Species: Hu
Applications: IHC, IHC-P, WB
NLS2756
Species: Hu, Pm
Applications: ICC, IHC, IHC-P
H00005998-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
MAB8458
Species: Hu
Applications: CyTOF-ready, Flow, ICC

Publications for RGS7 Antibody (NBP2-86776) (0)

There are no publications for RGS7 Antibody (NBP2-86776).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RGS7 Antibody (NBP2-86776) (0)

There are no reviews for RGS7 Antibody (NBP2-86776). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RGS7 Antibody (NBP2-86776) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RGS7 Products

Bioinformatics Tool for RGS7 Antibody (NBP2-86776)

Discover related pathways, diseases and genes to RGS7 Antibody (NBP2-86776). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RGS7 Antibody (NBP2-86776)

Discover more about diseases related to RGS7 Antibody (NBP2-86776).
 

Pathways for RGS7 Antibody (NBP2-86776)

View related products by pathway.

PTMs for RGS7 Antibody (NBP2-86776)

Learn more about PTMs related to RGS7 Antibody (NBP2-86776).
 

Research Areas for RGS7 Antibody (NBP2-86776)

Find related products by research area.

Blogs on RGS7

There are no specific blogs for RGS7, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RGS7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RGS7