Recombinant Human RCSD 1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RCSD 1 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 106 of Human RCSD1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MEKATEVKGERVQNEEVGPEHDSQETKKLEEGAAVKETPHSPPGGVKGGDVPKQEKGKEKQQEGAVLEPGCSPQTGPAQLETSSEVQSEPAVPKPEDDTPVQDTKM

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
RCSD1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RCSD 1 Protein

  • capZ-interacting protein
  • CAPZIP
  • MGC126585
  • MGC126611
  • MGC21854
  • MK2S4
  • Protein kinase substrate CapZIP
  • protein kinase substrate MK2S4
  • RCSD domain containing 1
  • RCSD domain-containing protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1519
Species: Hu
Applications: WB, IHC
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
H00009261-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-02500
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86632
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5414
Species: Hu
Applications: WB, Simple Western
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
H00007867-M02
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, PLA
NBP1-85922
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85614
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-90626
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12553
Species: Hu
NBP2-57588
Species: Hu
Applications: WB, ICC/IF
NBP1-57508
Species: Hu
Applications: WB, IHC, IHC-P
AF8107
Species: Hu
Applications: WB, IHC
NBP1-82458
Species: Hu
Applications: IHC, IHC-P
NBP1-85214
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RCSD 1 Recombinant Protein (H00092241-P01) (0)

There are no publications for RCSD 1 Recombinant Protein (H00092241-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RCSD 1 Recombinant Protein (H00092241-P01) (0)

There are no reviews for RCSD 1 Recombinant Protein (H00092241-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RCSD 1 Recombinant Protein (H00092241-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RCSD 1 Products

Bioinformatics Tool for RCSD 1 Recombinant Protein (H00092241-P01)

Discover related pathways, diseases and genes to RCSD 1 Recombinant Protein (H00092241-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RCSD 1 Recombinant Protein (H00092241-P01)

Discover more about diseases related to RCSD 1 Recombinant Protein (H00092241-P01).
 

Pathways for RCSD 1 Recombinant Protein (H00092241-P01)

View related products by pathway.

PTMs for RCSD 1 Recombinant Protein (H00092241-P01)

Learn more about PTMs related to RCSD 1 Recombinant Protein (H00092241-P01).
 

Research Areas for RCSD 1 Recombinant Protein (H00092241-P01)

Find related products by research area.

Blogs on RCSD 1

There are no specific blogs for RCSD 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

RCSD 1 Antibody (3F6)
H00092241-M01

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RCSD 1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RCSD1