Recombinant Human RC74 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RC74 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-658 of Human INTS9 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MKLYCLSGHPTLPCNVLKFKSTTIMLDCGLDMTSTLNFLPLPLVQSPRLSNLPGWSLKDGNAFLDKELKECSGHVFVDSVPEFCLPETELIDLSTVDVILISNYHCMMALPYITEHTGFTGTVYATEPTVQIGRLLMEELVNFIERVPKAQSASLWKNKDIQRLLPSPLKDAVEVSTWRRCYTMQEVNSALSKIQLVGYSQKIELFGAVQVTPLSSGYALGSSNWIIQSHYEKVSYVSGSSLLTTHPQPMDQASLKNSDVLVLTGLTQIPTANPDGMVGEFCSNLALTVRNGGNVLVPCYPSGVIYDLLECLYQYIDSAGLSSVPLYFISPVANSSLEFSQIFAEWLCHNKQSKVYLPEPPFPHAELIQTNKLKHYPSIHGDFSNDFRQPCVVFTGHPSLRFGDVVHFMELWGKSSLNTVIFTEPDFSYLEALAPYQPLAMKCIYCPIDTRLNFIQVSKLLKEVQPLHVVCPEQYTQPPPAQSHRMDLMIDCQPPAMSYRRAEVLALPFKRRYEKIEIMPELADSLVPMEIKPGISLATVSAVLHTKDNKHLLQPPPRPAQPTSGKKRKRVSDDVPDCKVLKPLLSGSIPVEQFVQTLEKHGFSDIKVEDTAKGHIVLLQEAETLIQIEEDSTHIICDNDEMLRVRLRDLVLKFLQKF

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
INTS9

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RC74 Protein

  • CPSF2L
  • FLJ10871
  • INT9
  • integrator complex subunit 9
  • Protein related to CPSF subunits of 74 kDa
  • RC74
  • RC-74

Background

INTS9 is a subunit of the Integrator complex, which associates with the C-terminal domain of RNA polymerase II large subunit (POLR2A; MIM 180660) and mediates 3-prime end processing of small nuclear RNAs U1 (RNU1; MIM 180680) and U2 (RNU2; MIM 180690) (Baillat et al., 2005 [PubMed 16239144]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-60638
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-417
Species: Hu, Mu, Rt, Ca, Pl
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-79823
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP
NBP2-02136
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00051692-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
MAB1228
Species: Hu
Applications: Flow, IHC, IP, CyTOF-ready

Publications for RC74 Recombinant Protein (H00055756-P01) (0)

There are no publications for RC74 Recombinant Protein (H00055756-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RC74 Recombinant Protein (H00055756-P01) (0)

There are no reviews for RC74 Recombinant Protein (H00055756-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RC74 Recombinant Protein (H00055756-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RC74 Products

Bioinformatics Tool for RC74 Recombinant Protein (H00055756-P01)

Discover related pathways, diseases and genes to RC74 Recombinant Protein (H00055756-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for RC74 Recombinant Protein (H00055756-P01)

View related products by pathway.

PTMs for RC74 Recombinant Protein (H00055756-P01)

Learn more about PTMs related to RC74 Recombinant Protein (H00055756-P01).

Blogs on RC74

There are no specific blogs for RC74, but you can read our latest blog posts.

Customers Who Bought This Also Bought

RC74 Antibody
NBP2-57534
INTS11 Antibody
NB100-60638

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RC74 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol INTS9