RBM4B Antibody

Images

 
Western Blot: RBM4B Antibody [NBP1-80469] - Titration: 2.5ug/ml Positive Control: Jurkat cell lysate.
Immunohistochemistry-Paraffin: RBM4B Antibody [NBP1-80469] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RBM4B Antibody Summary

Immunogen
Synthetic peptide directed towards the C terminal of human RBM4B. Peptide sequence AAAATTSSYYGRDRSPLRRAAAMLPTVGEGYGYGPESELSQASAATRNSL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RBM4B
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against RBM4B and was validated on Western Blot and immunohistochemistry.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RBM4B Antibody

  • MGC10871
  • RBM30
  • RBM4L
  • RNA binding motif protein 30
  • RNA binding motif protein 4B
  • RNA-binding motif protein 30
  • RNA-binding motif protein 4B
  • RNA-binding protein 30
  • RNA-binding protein 4B
  • ZCCHC15
  • ZCRB3B
  • zinc finger CCHC-type and RNA binding motif 3B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33503
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1177
Species: Hu, Mu
Applications: WB, Simple Western, IHC
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB110-41536
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-87127
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80469
Species: Hu
Applications: WB, IHC, IHC-P

Publications for RBM4B Antibody (NBP1-80469) (0)

There are no publications for RBM4B Antibody (NBP1-80469).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RBM4B Antibody (NBP1-80469) (0)

There are no reviews for RBM4B Antibody (NBP1-80469). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RBM4B Antibody (NBP1-80469) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RBM4B Products

Bioinformatics Tool for RBM4B Antibody (NBP1-80469)

Discover related pathways, diseases and genes to RBM4B Antibody (NBP1-80469). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on RBM4B

There are no specific blogs for RBM4B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RBM4B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RBM4B
Uniprot