RBM47 Antibody

Product Discontinued

RBM47 Antibody Summary

• Immunogen: Synthetic peptides corresponding to RBM47(RNA binding motif protein 47) The peptide sequence was selected from the middle region of RBM47. Peptide sequence HFTSREDAVHAMNNLNGTELEGSCLEVTLAKPVDKEQYSRYQKAARGGGA. The peptide sequence for this immunogen was taken from within the described region.
• Predicted Species: Mouse (100%), Rat (100%), Canine (100%), Equine (100%), Zebrafish (93%), Rabbit (100%), Guinea Pig (100%), Bovine (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RBM47
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:100-1:2000
• Application Notes: This is a rabbit polyclonal antibody against RBM47 and was validated on Western blot.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS & 2% Sucrose.
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified
• Reconstitution Instructions: Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for RBM47 Antibody

• DKFZp686F02235
• FLJ20273
• FLJ21344
• FLJ21643
• NET18
• RNA binding motif protein 47
• RNA-binding motif protein 47
• RNA-binding protein 47

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RBM47
• Uniprot:
  • A0AV96-2(Human)