Recombinant Human RAB9B Protein

Images

 
SDS-Page: Recombinant Human RAB9B Protein [H00051209-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human RAB9B Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 102-201 of Human RAB9B

Source: Wheat Germ

Amino Acid Sequence: QKEFIYYADVKDPEHFPFVVLGNKVDKEDRQVTTEEAQTWCMENGDYPYLETSAKDDTNVTVAFEEAVRQVLAVEEQLEHCMLGHTIDLNSGSKAGSSCC

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
RAB9B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RAB9B Protein

  • RAB9B, member RAS oncogene family
  • Rab-9L
  • RAB9-like protein
  • RAB9LRab-9-like protein
  • ras-related protein Rab-9B

Background

RAB9B - RAB9B, member RAS oncogene family

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87781
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-75531
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-621
Species: Hu, Rt, Bv, Ca, Ha, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IM, IP
NBP1-82016
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33910
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-75483
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46587
Species: Hu
Applications: WB, IHC
NB110-60011
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00006532-D01P
Species: Hu, Mu
Applications: WB, Flow
NBP1-54435
Species: Hu
Applications: WB, Flow, IP
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82639
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4696
Species: Hu, Rt
Applications: WB, IHC
NBP2-01346
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87249
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00051209-Q01
Species: Hu
Applications: WB, ELISA, PA, PAGE, AP

Publications for RAB9B Partial Recombinant Protein (H00051209-Q01) (0)

There are no publications for RAB9B Partial Recombinant Protein (H00051209-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAB9B Partial Recombinant Protein (H00051209-Q01) (0)

There are no reviews for RAB9B Partial Recombinant Protein (H00051209-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RAB9B Partial Recombinant Protein (H00051209-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional RAB9B Products

Bioinformatics Tool for RAB9B Partial Recombinant Protein (H00051209-Q01)

Discover related pathways, diseases and genes to RAB9B Partial Recombinant Protein (H00051209-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RAB9B Partial Recombinant Protein (H00051209-Q01)

Discover more about diseases related to RAB9B Partial Recombinant Protein (H00051209-Q01).
 

Pathways for RAB9B Partial Recombinant Protein (H00051209-Q01)

View related products by pathway.

Research Areas for RAB9B Partial Recombinant Protein (H00051209-Q01)

Find related products by research area.

Blogs on RAB9B

There are no specific blogs for RAB9B, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RAB9B Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB9B