Recombinant Human RAB40A Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RAB40A Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 139 - 238 of Human RAB40A partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:EQAQAYAERLGVTFFEVSPLCNFNIIESFTELARIVLLRHRMNWLGRPSKVLSLQDLCCRTIVSCTPVHLVDKLPLPSTLRSHLKSFSMAKGLNARMMRG

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
RAB40A

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RAB40A Protein

  • MGC142061
  • Protein Rar-2
  • RAB40A, member RAS oncogene family
  • RAR2
  • Rar-2
  • RAR2A
  • ras-related protein Rab-40A
  • SOCS box containing protein RAR2A
  • SOCS box-containing protein RAR2A

Background

RAB40A - RAB40A, member RAS oncogene family

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
NBP1-90223
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5540
Species: Mu
Applications: WB
MAB6799
Species: Hu
Applications: WB, IHC
NBP1-58922
Species: Hu
Applications: WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00057799-T01
Species: Hu
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
H00142684-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for RAB40A Partial Recombinant Protein (H00142684-Q01) (0)

There are no publications for RAB40A Partial Recombinant Protein (H00142684-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAB40A Partial Recombinant Protein (H00142684-Q01) (0)

There are no reviews for RAB40A Partial Recombinant Protein (H00142684-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RAB40A Partial Recombinant Protein (H00142684-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RAB40A Products

Bioinformatics Tool for RAB40A Partial Recombinant Protein (H00142684-Q01)

Discover related pathways, diseases and genes to RAB40A Partial Recombinant Protein (H00142684-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for RAB40A Partial Recombinant Protein (H00142684-Q01)

View related products by pathway.

Research Areas for RAB40A Partial Recombinant Protein (H00142684-Q01)

Find related products by research area.

Blogs on RAB40A

There are no specific blogs for RAB40A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SP1 Antibody
NB600-233

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RAB40A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RAB40A