Recombinant Human PTPLB GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human PTPLB GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-254 of Human PTPLB

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MAAVAATAAAKGNGGGGGRAGAGDASGTRKKKGPGPLATAYLVIYNVVMTAGWLVIAVGLVRAYLAKGSYHSLYYSIEKPLKFFQTGALLEILHCAIGIVPSSVVLTSFQVMSRVFLIWAVTHSVKEVQSEDSVLLFVIAWTITEIIRYSFYTFSLLNHLPYLIKWARYTLFIVLYPMGVSGELLTIYAALPFVRQAGLYSISLPNKYNFSFDYYAFLILIMISYIPIFPQLYFHMIHQRRKILSHTEEHKKFE

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
PTPLB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
54.8 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PTPLB GST (N-Term) Protein

  • EC 4.2.1.-
  • HACD2,3-hydroxyacyl-CoA dehydratase 2
  • member b
  • protein tyrosine phosphatase-like (proline instead of catalytic arginine)
  • Protein-tyrosine phosphatase-like member B

Background

PTPLB, also known as Protein-Tyrosine Phosphatase-Like Member B, is a short, 254 amino acid long protein that is approximately 28kDa. PTPLB localizes to the membrane of the Endoplasmic Reticulum and is ubiquitously expressed in a variety of tissues including heart, spleen, prostate, colon, and testes. PTPLB is involved in VLCFA synthesis and interacts with BCAP31 and members of the ELOVL family of enzymes. Current research on PTPLB is being performed in relation to several diseases and disorders including malaria and prostatitis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89357
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-35145
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-93264
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-80754
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
NBP1-85437
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB2669
Species: Hu
Applications: IHC, Simple Western, WB
NB100-40853
Species: Hu
Applications: IHC,  IHC-P, IP, WB

Publications for PTPLB Recombinant Protein (H00201562-P01) (0)

There are no publications for PTPLB Recombinant Protein (H00201562-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTPLB Recombinant Protein (H00201562-P01) (0)

There are no reviews for PTPLB Recombinant Protein (H00201562-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PTPLB Recombinant Protein (H00201562-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PTPLB Products

Research Areas for PTPLB Recombinant Protein (H00201562-P01)

Find related products by research area.

Blogs on PTPLB

There are no specific blogs for PTPLB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PTPLB GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PTPLB