Protocadherin-12 Antibody

Images

 
Immunohistochemistry-Paraffin: Protocadherin-12 Antibody [NBP2-13737] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Protocadherin-12 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ENNLPSLHLITIKAHDADLGINGKVSYRIQDSPVAHLVAIDSNTGEVTAQ RSLNYEEMAGFEFQVIAEDSGQPMLASSVSVWVS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PCDH12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Protocadherin-12 Protein (NBP2-13737PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Protocadherin-12 Antibody

  • PCDH12
  • protocadherin 12
  • Protocadherin12
  • Protocadherin-12
  • Vascular cadherin-2
  • vascular endothelial cadherin 2
  • Vascular endothelial cadherin-2
  • VECAD2
  • VE-cad-2
  • VE-cadherin 2
  • VE-cadherin-2
  • VE-cadherin-2protocadherin-12

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-53235
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NBP2-19719
Species: Hu
Applications: WB, IHC, IHC-P
NB600-1081
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-49512
Species: Hu
Applications: IHC
NB100-2693
Species: Dr
Applications: WB, ELISA, ICC/IF, IHC
MAB7278
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-82120
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF761
Species: Mu
Applications: WB, Simple Western, Flow, IHC, AdBlk, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-46403
Species: Hu
Applications: IHC
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB2240
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
MAB8626
Species: Hu
Applications: Flow, CyTOF-ready

Publications for Protocadherin-12 Antibody (NBP2-13737) (0)

There are no publications for Protocadherin-12 Antibody (NBP2-13737).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Protocadherin-12 Antibody (NBP2-13737) (0)

There are no reviews for Protocadherin-12 Antibody (NBP2-13737). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Protocadherin-12 Antibody (NBP2-13737) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Protocadherin-12 Products

Bioinformatics Tool for Protocadherin-12 Antibody (NBP2-13737)

Discover related pathways, diseases and genes to Protocadherin-12 Antibody (NBP2-13737). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Protocadherin-12 Antibody (NBP2-13737)

Discover more about diseases related to Protocadherin-12 Antibody (NBP2-13737).
 

Pathways for Protocadherin-12 Antibody (NBP2-13737)

View related products by pathway.

PTMs for Protocadherin-12 Antibody (NBP2-13737)

Learn more about PTMs related to Protocadherin-12 Antibody (NBP2-13737).

Blogs on Protocadherin-12

There are no specific blogs for Protocadherin-12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Protocadherin-12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PCDH12
Entrez