Protocadherin-12 Antibody

Immunohistochemistry-Paraffin: Protocadherin-12 Antibody [NBP2-13737] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Discontinued

Protocadherin-12 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: ENNLPSLHLITIKAHDADLGINGKVSYRIQDSPVAHLVAIDSNTGEVTAQRSLNYEEMAGFEFQVIAEDSGQPMLASSVSVWVS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PCDH12
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (86%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Protocadherin-12 Antibody

• PCDH12
• protocadherin 12
• Protocadherin12
• Protocadherin-12
• Vascular cadherin-2
• vascular endothelial cadherin 2
• Vascular endothelial cadherin-2
• VECAD2
• VE-cad-2
• VE-cadherin 2
• VE-cadherin-2
• VE-cadherin-2protocadherin-12

Background

The Protocadherin 12 gene belongs to the protocadherin gene family, a subfamily of the cadherin superfamily. The encoded protein consists of an extracellular domain containing 6 cadherin repeats, a transmembrane domain and a cytoplasmic tail that differs from those of th

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PCDH12