Protocadherin-12 Antibody Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the amino acids: ENNLPSLHLITIKAHDADLGINGKVSYRIQDSPVAHLVAIDSNTGEVTAQRSLNYEEMAGFEFQVIAEDSGQPMLASSVSVWVS |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PCDH12 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (86%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for Protocadherin-12 Antibody
Background
The Protocadherin 12 gene belongs to the protocadherin gene family, a subfamily of the cadherin superfamily. The encoded protein consists of an extracellular domain containing 6 cadherin repeats, a transmembrane domain and a cytoplasmic tail that differs from those of th
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: Dual ISH-IHC, IHC, Simple Western, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: BA
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu
Applications: ELISA
Species: Mu
Applications: AdBlk, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
Species: Hu
Applications: EnzAct
Species: Hu, Mu
Applications: IP, WB
Publications for Protocadherin-12 Antibody (NBP2-13737) (0)
There are no publications for Protocadherin-12 Antibody (NBP2-13737).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Protocadherin-12 Antibody (NBP2-13737) (0)
There are no reviews for Protocadherin-12 Antibody (NBP2-13737).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Protocadherin-12 Antibody (NBP2-13737) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Protocadherin-12 Products
Blogs on Protocadherin-12