PRDM11 Antibody - BSA Free

Western Blot: PRDM11 Antibody [NBP2-85528] - Host: Rabbit. Target Name: PRDM11. Sample Type: 721_B Whole cell lysates. Antibody Dilution: 1.0ug/mlPRDM11 is supported by BioGPS gene expression data to be expressed in 721_B

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

PRDM11 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PRDM11 Antibody - BSA Free (NBP2-85528) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human PRDM11. Peptide sequence: IGQTQGEGDWKVPQGVSKEPGQLEDEEEEPSSFKADSPAEASLASDPHEL The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PRDM11
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for PRDM11 Antibody - BSA Free

• PFM8PR domain-containing protein 11
• PR domain containing 11
• PR-domain containing protein 11

Background

The newly discovered family of PR domain genes is involved in tumorigenesis. Similar to acetylation and phosphorylation, histone methylation at the N-terminal tail has emerged as an important role in regulating chromatin dynamics and gene activity. Histone methylation occurs on arginine and lysine residues and is catalyzed by two families of proteins, the protein arginine methyltransferase family and the SET-domain containing methyltransferase family. Five members have been identified in the arginine methyltransferase family. About 27 are grouped into the SET-domain family, and another 17 make up the PR domain family that is related to the SET domain family. The retinoblastoma protein interacting zinc finger gene RIZ1 is a tumor suppressor gene and a FOUNDING member of the PR domain family. RIZ1 inactivation is commonly found in many types of human cancers and occurs through loss of mRNA expression, frame shift mutation, chromosomal deletion, and missense mutation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PRDM11