PPAPDC3 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: PPAPDC3 Antibody [NBP2-56028] - Staining of human cell line U-2 OS shows localization to vesicles.

Immunohistochemistry-Paraffin: PPAPDC3 Antibody [NBP2-56028] - Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PPAPDC3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PPAPDC3 Antibody - BSA Free (NBP2-56028) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GPYETSPSLLDYLTMDIYAFPAGHASRAAMVSK
• Predicted Species: Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PLPP7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PPAPDC3 Recombinant Protein Antigen (NBP2-56028PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PPAPDC3 Antibody - BSA Free

• C9orf67
• chromosome 9 open reading frame 67
• EC 3.1.3
• EC 3.1.3.-
• FLJ14662
• KIAA0515
• MGC12921
• NET39
• phosphatidic acid phosphatase type 2 domain containing 3
• Phosphatidic acid phosphatase type 2 domain-containing protein 3
• probable lipid phosphate phosphatase PPAPDC3

Background

PPAPDC3 plays a role as negative regulator of myoblast differentiation, in part through effects on MTOR signaling.Has no detectable enzymatic activity

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PLPP7