We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Pin1 Recombinant Protein Antigen

Images

 
There are currently no images for Pin1 Recombinant Protein Antigen (NBP3-21340PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Pin1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Pin1

Source: E.coli

Amino Acid Sequence: RSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PIN1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21340. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Pin1 Recombinant Protein Antigen

  • dod
  • EC 5.2.1.8
  • peptidylprolyl cis/trans isomerase, NIMA-interacting 1
  • peptidyl-prolyl cis/trans isomerase, NIMA-interacting
  • peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
  • Peptidyl-prolyl cis-trans isomerase Pin1
  • Pin1
  • PPIase Pin1
  • prolyl isomerase
  • protein (peptidyl-prolyl cis/trans isomerase) NIMA-interacting 1
  • protein (peptidylprolyl cis/trans isomerase) NIMA-interacting 1
  • Rotamase Pin1
  • UBL5

Background

Pin-1 is a the peptidylprolyl cis/trans isomerase enzyme which is responsible, as its name suggests, for flipping the proline ring from the cis to the trans conformation. This enzyme is heavily upregulated in tumor cells, so that antibodies to this protein can be used as tumor markers. Pin-1 protein is concentrated in the nucleus in small punctate structures and is particularly obvious in tumor cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-00253
Species: Hu
Applications: ELISA, IHC,  IHC-P, IP, WB
NB110-68281
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, Simple Western, WB
MAB4356
Species: Hu, Mu, Rt
Applications: WB
MAB3777
Species: Hu, Mu, Rt
Applications: WB
NBP2-67702
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB110-96874
Species: Ca, Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-49242
Species: Hu
Applications: IHC,  IHC-P, WB
AF4094
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
NBP1-85360
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-88766
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-38905
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-83889
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-87929
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF4174
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP1-85921
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-13794
Species: Hu
Applications: ICC/IF,  IHC-P, WB
NBP1-83887
Species: Hu
Applications: ICC/IF,  IHC-P, WB
NBP2-46420
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-32840
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB

Publications for Pin1 Recombinant Protein Antigen (NBP3-21340PEP) (0)

There are no publications for Pin1 Recombinant Protein Antigen (NBP3-21340PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pin1 Recombinant Protein Antigen (NBP3-21340PEP) (0)

There are no reviews for Pin1 Recombinant Protein Antigen (NBP3-21340PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Pin1 Recombinant Protein Antigen (NBP3-21340PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Pin1 Products

Research Areas for Pin1 Recombinant Protein Antigen (NBP3-21340PEP)

Find related products by research area.

Blogs on Pin1

There are no specific blogs for Pin1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Pin1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PIN1