Recombinant Human Phospholipase A2 XII Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Phospholipase A2 XII Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 90-188 of Human PLA2G12A partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:PLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHYEEKTD

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PLA2G12A

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Phospholipase A2 XII Protein

  • EC 3.1.1.4
  • group XII secreted phospholipase A2
  • group XIIA secreted phospholipase A2
  • group XIIA secretory phospholipase A2
  • GXII sPLA2
  • GXII
  • Phosphatidylcholine 2-acylhydrolase 12A
  • phospholipase A2, group XII
  • phospholipase A2, group XIIA
  • PLA2G12
  • ROSSY
  • sPLA2-XII

Background

PLA2G12A - phospholipase A2, group XIIA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00008399-D01P
Species: Hu, Rt
Applications: WB
NBP2-31685
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4925
Species: Mu
Applications: WB, Simple Western, IHC
NBP2-14101
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB5018
Species: Hu
Applications: WB, IP
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45808
Species: Hu
Applications: IHC
AF4937
Species: Hu
Applications: WB, IHC
NB100-56656
Species: Hu, Mu, Rt
Applications: WB
NBP1-84449
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-19809
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31558
Species: Hu
Applications: WB, IHC, IHC-P
H00001032-M08
Species: Hu
Applications: WB, ELISA, IP
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-83367
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-11228
Species: Hu
H00081579-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Phospholipase A2 XII Partial Recombinant Protein (H00081579-Q01) (0)

There are no publications for Phospholipase A2 XII Partial Recombinant Protein (H00081579-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Phospholipase A2 XII Partial Recombinant Protein (H00081579-Q01) (0)

There are no reviews for Phospholipase A2 XII Partial Recombinant Protein (H00081579-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Phospholipase A2 XII Partial Recombinant Protein (H00081579-Q01). (Showing 1 - 2 of 2 FAQ).

  1. Our customer asked about the cross reactivity of PLA2G12A antibodies. Do you have any info if these antibodies?
    • Unless specifically indicated on the datasheet they are not tested to recognize other phospholipases. The immunogen information is present for all of those so that might give some clues to the customer as to whether they might have some reactivity, but as far as direct testing is concerned on the other phospholipases this has not been performed by the lab.
  2. Our customer asked about the cross reactivity of PLA2G12A antibodies. Do you have any info if these antibodies recognize other phospholipases?
    • Unless specifically indicated on the datasheet they are not tested to recognize other phospholipases. The immunogen information is present for all of those so that might give some clues to the customer as to whether they might have some reactivity, but as far as direct testing is concerned on the other phospholipases this has not been performed by the lab.

Additional Phospholipase A2 XII Products

Bioinformatics Tool for Phospholipase A2 XII Partial Recombinant Protein (H00081579-Q01)

Discover related pathways, diseases and genes to Phospholipase A2 XII Partial Recombinant Protein (H00081579-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Phospholipase A2 XII Partial Recombinant Protein (H00081579-Q01)

Discover more about diseases related to Phospholipase A2 XII Partial Recombinant Protein (H00081579-Q01).
 

Pathways for Phospholipase A2 XII Partial Recombinant Protein (H00081579-Q01)

View related products by pathway.

Research Areas for Phospholipase A2 XII Partial Recombinant Protein (H00081579-Q01)

Find related products by research area.

Blogs on Phospholipase A2 XII

There are no specific blogs for Phospholipase A2 XII, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Phospholipase A2 XII Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PLA2G12A