PHF15 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

PHF15 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PHF15.

  Source: E. coli

  Amino Acid Sequence: IDGTFFNSWLAQSVQITAENMAMSEWPLNNGHREDPAPGLLSEELLQDEETLLSFMRDPSLRPGDPARKARG

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: PHF15
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55528.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 26 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PHF15 Recombinant Protein Antigen

• PHD finger protein 15KIAA0239JADE2
• protein Jade-2

Background

PHF15, also known as Protein Jade-2, has 3 isoforms, a 790 amino acid isoform that is 87 kDa, a 789 amino acid isoform that is 87 kDa and a 562 amino acid isoform that is 63 kDa, has a histone H4-specific acetyltransferase activity as a component of the HBO1complex, a reduced activity toward histone H3 and is responsible for the bulk of histone H4 acetylation in vivo. This protein has been shown an interaction with ING4, KAT7, ING5, PACSIN, ZBTB3, ZBTB5, ZNF496, and VHL proteins in histone H3 acetylation, histone H4-K5 acetylation, histone H4-K8 acetylation, and histone H4-K12 acetylation biological processes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: PHF15