We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

PCDHAC2 Antibody - BSA Free

Images

 
Immunocytochemistry/ Immunofluorescence: PCDHAC2 Antibody [NBP2-56046] - Staining of human cell line A549 shows localization to nucleoplasm & mitochondria.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

PCDHAC2 Antibody - BSA Free Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ('CGVRERSPAELYKQANNNIDARIPHGLKVQPHFIEVRGNGSLTKTYCYKACLTAGSGSDTFMFYNTGAQTGPGPSGAQAAVTDSRNLTGQSGQNAGNLII',)
Predicted Species
Mouse (91%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PCDHAC2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PCDHAC2 Recombinant Protein Antigen (NBP2-56046PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for PCDHAC2 Antibody - BSA Free

  • MGC71598
  • PCDH-ALPHA-C2
  • protocadherin alpha subfamily C, 2
  • protocadherin alpha-C2

Background

PCDHAC2 is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The alpha gene cluster is composed of 15 cadherin superfamily genes related to the mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences. The tandem array of 15 N-terminal exons, or variable exons, are followed by downstream C-terminal exons, or constant exons, which are shared by all genes in the cluster. The large, uninterrupted N-terminal exons each encode six cadherin ectodomains while the C-terminal exons encode the cytoplasmic domain. These neural cadherin-like cell adhesion proteins are integral plasma membrane proteins that most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been observed and additional variants have been suggested but their full-length nature has yet to be determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-229
Species: Ch, Hu(-), Ma, Pm, Mu, Pa, Rt
Applications: ChIP, ChIP, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP1-59214
Species: Hu
Applications: WB

Publications for PCDHAC2 Antibody (NBP2-56046) (0)

There are no publications for PCDHAC2 Antibody (NBP2-56046).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCDHAC2 Antibody (NBP2-56046) (0)

There are no reviews for PCDHAC2 Antibody (NBP2-56046). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PCDHAC2 Antibody (NBP2-56046) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PCDHAC2 Products

Research Areas for PCDHAC2 Antibody (NBP2-56046)

Find related products by research area.

Blogs on PCDHAC2

There are no specific blogs for PCDHAC2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PCDHAC2 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol PCDHAC2