Recombinant Human PC6 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human PC6 Protein [H00005125-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human PC6 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 804-913 of Human PC6

Source: Wheat Germ (in vitro)

Amino Acid Sequence: TEGYFMEDGRCVQSCSISYYFDHSSENGYKSCKKCDISCLTCNGPGFKNCTSCPSGYLLDLGMCQMGAICKDATEESWAEGGFCMLVKKNNLCQRKVLQQLCCKTCTFQG

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
PCSK5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PC6 GST (N-Term) Protein

  • EC 3.4.21
  • EC 3.4.21.-
  • EC 3.4.21.61
  • EC 3.4.21.75
  • FLJ11149
  • FLJ16215
  • hPC6
  • PC5PC6A
  • PC6prohormone convertase 5
  • Proprotein convertase 5
  • Proprotein convertase 6
  • proprotein convertase PC5
  • proprotein convertase subtilisin/kexin type 5
  • protease PC6
  • SPC6
  • Subtilisin/kexin-like protease PC5

Background

The protein encoded by this gene belongs to the subtilisin-like proprotein convertase family. The members of this family are proprotein convertases that process latent precursor proteins into their biologically active products. This encoded protein mediates posttranslational endoproteolytic processing for several integrin alpha subunits. It is thought to process prorenin, pro-membrane type-1 matrix metalloproteinase and HIV-1 glycoprotein gp160. Two alternatively spliced transcripts are described for this gene but only one has its full length nature known. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1903
Species: Hu, Mu, Rt, Po, Ca, Ha, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, B/N
H00005122-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
H00005046-A01
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP2-73621
Species: Hu
Applications: Flow, ICC/IF, CyTOF-ready
AF6018
Species: Hu, Mu
Applications: WB, IP, ICC
NBP2-29421
Species: Hu, Rt, Po, Bv, Gt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-52432
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
NBP1-30117
Species: Hu, Mu
Applications: WB, IP
NBP2-14924
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27561
Species: Hu, Rt, Ch
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-88010
Species: Hu
Applications: IHC, IHC-P
NBP1-82454
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24679
Species: Hu, Po, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
NBP1-83224
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15275
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46587
Species: Hu
Applications: WB, IHC
NBP3-05160
Species: Hu
Applications: ICC/IF, IHC

Publications for PC6 Partial Recombinant Protein (H00005125-Q01) (0)

There are no publications for PC6 Partial Recombinant Protein (H00005125-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PC6 Partial Recombinant Protein (H00005125-Q01) (0)

There are no reviews for PC6 Partial Recombinant Protein (H00005125-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PC6 Partial Recombinant Protein (H00005125-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional PC6 Products

Array H00005125-Q01

Bioinformatics Tool for PC6 Partial Recombinant Protein (H00005125-Q01)

Discover related pathways, diseases and genes to PC6 Partial Recombinant Protein (H00005125-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PC6 Partial Recombinant Protein (H00005125-Q01)

Discover more about diseases related to PC6 Partial Recombinant Protein (H00005125-Q01).
 

Pathways for PC6 Partial Recombinant Protein (H00005125-Q01)

View related products by pathway.

PTMs for PC6 Partial Recombinant Protein (H00005125-Q01)

Learn more about PTMs related to PC6 Partial Recombinant Protein (H00005125-Q01).

Blogs on PC6

There are no specific blogs for PC6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PC6 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PCSK5