Recombinant Human P2X2/P2RX2 Protein

Images

 
SDS-Page: Recombinant Human P2X2/P2RX2 Protein [H00022953-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human P2X2/P2RX2 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 128-205 of Human P2X2/P2RX2

Source: Wheat Germ

Amino Acid Sequence: KNSIHYPKFHFSKGNIADRTDGYLKRCTFHEASDLYCPIFKLGFIVEKAGESFTELAHKGGVIGVIINWDCDLDLPAS

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
P2RX2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
34.32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human P2X2/P2RX2 Protein

  • ATP receptor
  • MGC129601
  • P2RX2
  • P2X purinoceptor 2
  • P2X2
  • P2X2P2X Receptor, subunit 2
  • purinergic receptor P2X, ligand-gated ion channel, 2
  • Purinergic receptor

Background

The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Binding to ATP mediates synaptic transmission between neurons and from neurons to smooth muscle. Six transcript variants encoding six distinct isoforms have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1654
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-92239
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32470
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P
NBP1-30565
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP1-82441
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-39032
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30741
Species: Hu, Mu, Rt, GP
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-75604
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-61760
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF640
Species: Mu
Applications: WB, IHC
NBP1-78249
Species: Hu, Rt, Pm
Applications: WB, DB, ELISA, ICC/IF, IHC, IHC-P, IP
H00022953-Q01
Species: Hu
Applications: WB, ELISA, PA, PAGE, AP

Publications for P2X2/P2RX2 Partial Recombinant Protein (H00022953-Q01) (0)

There are no publications for P2X2/P2RX2 Partial Recombinant Protein (H00022953-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for P2X2/P2RX2 Partial Recombinant Protein (H00022953-Q01) (0)

There are no reviews for P2X2/P2RX2 Partial Recombinant Protein (H00022953-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for P2X2/P2RX2 Partial Recombinant Protein (H00022953-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for P2X2/P2RX2 Partial Recombinant Protein (H00022953-Q01)

Discover related pathways, diseases and genes to P2X2/P2RX2 Partial Recombinant Protein (H00022953-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for P2X2/P2RX2 Partial Recombinant Protein (H00022953-Q01)

Discover more about diseases related to P2X2/P2RX2 Partial Recombinant Protein (H00022953-Q01).
 

Pathways for P2X2/P2RX2 Partial Recombinant Protein (H00022953-Q01)

View related products by pathway.

PTMs for P2X2/P2RX2 Partial Recombinant Protein (H00022953-Q01)

Learn more about PTMs related to P2X2/P2RX2 Partial Recombinant Protein (H00022953-Q01).
 

Research Areas for P2X2/P2RX2 Partial Recombinant Protein (H00022953-Q01)

Find related products by research area.

Blogs on P2X2/P2RX2

There are no specific blogs for P2X2/P2RX2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

P2Y2 Antibody
NB110-39032

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human P2X2/P2RX2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol P2RX2