p130Cas/BCAR1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

p130Cas/BCAR1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human p130Cas/BCAR1
  
  

  Source: E.coli

  Amino Acid Sequence: SGATLEDLDRLVACSRAVPEDAKQLASFLHGNASLLFRRTKATAPGPEGGGTLHPNPTDKTSSIQSRPLPSPPKFTSQDSPDGQYEN

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: BCAR1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25033It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for p130Cas/BCAR1 Recombinant Protein Antigen

• BCAR1
• breast cancer estrogen resistance 1
• Cas scaffolding protein family member 1
• CAS1
• CASFLJ45059
• CASS1
• CASS1CRKASbreast cancer estrogen resistance protein 1
• CRKAS
• Crk-associated substrate p130Cas
• CRK-associated substrate
• FLJ12176
• p130Cas

Background

BCAR1/p130CAS functions as a scaffolding protein for components of various kinase signaling pathways. It is involved in integrin signaling for cell motility as well as netrin signaling for the guidance of commissural axons. Overexpression of BCAR1/p130CAS has been shown to confer antiestrogen resistance in breast cancer cells. Alternate names for BCAR1/p130CAS include breast cancer anti-estrogen resistance protein 1, CRK-associated substrate, CAS scaffolding protein family member 1, CAS, and CRKAS.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BCAR1