Recombinant Human OSBPL3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human OSBPL3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 788-887 of Human OSBPL3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:FALELNEMDPSSKSLLPPTDTRFRPDQRFLEEGNLEEAEIQKQRIEQLQRERRRVLEENHVEHQPRFFRKSDDDSWVSNGTYLELRKDLGFSKLDHPVLW

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
OSBPL3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human OSBPL3 Protein

  • DKFZp667P1518
  • KIAA0704ORP3ORP-3OSBP3
  • MGC21526
  • OSBP-related protein 3
  • oxysterol binding protein-like 3
  • oxysterol-binding protein 3
  • oxysterol-binding protein-related protein 3

Background

This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain. Several transcript variants encoding different isoforms have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00935
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-31237
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
H00000518-R01
Species: Hu
MAB9120
Species: Hu
Applications: ICC
NBP1-49534
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-31456
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81054
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP2-46403
Species: Hu
Applications: IHC
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
NBP2-04611
Species: Hu
H00026031-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for OSBPL3 Partial Recombinant Protein (H00026031-Q01) (0)

There are no publications for OSBPL3 Partial Recombinant Protein (H00026031-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OSBPL3 Partial Recombinant Protein (H00026031-Q01) (0)

There are no reviews for OSBPL3 Partial Recombinant Protein (H00026031-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OSBPL3 Partial Recombinant Protein (H00026031-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional OSBPL3 Products

Bioinformatics Tool for OSBPL3 Partial Recombinant Protein (H00026031-Q01)

Discover related pathways, diseases and genes to OSBPL3 Partial Recombinant Protein (H00026031-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OSBPL3 Partial Recombinant Protein (H00026031-Q01)

Discover more about diseases related to OSBPL3 Partial Recombinant Protein (H00026031-Q01).
 

Pathways for OSBPL3 Partial Recombinant Protein (H00026031-Q01)

View related products by pathway.

PTMs for OSBPL3 Partial Recombinant Protein (H00026031-Q01)

Learn more about PTMs related to OSBPL3 Partial Recombinant Protein (H00026031-Q01).

Blogs on OSBPL3

There are no specific blogs for OSBPL3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

OSBPL3 Antibody
NBP1-82968

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human OSBPL3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol OSBPL3