Recombinant Human Orexin R2/HCRTR2 Protein

Images

 
Recombinant Human Orexin R2/HCRTR2 Protein [H00003062-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Orexin R2/HCRTR2 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-54 of Human Orexin R2/HCRTR2

Source: Wheat Germ

Amino Acid Sequence: MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYE

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
HCRTR2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
31.68 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 1 Review rated 5
using
H00003062-Q01 in the following application:

Publications
Read Publication using
H00003062-Q01 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Orexin R2/HCRTR2 Protein

  • HCRTR2
  • hypocretin (orexin) receptor 2
  • Hypocretin receptor type 2
  • Orexin R2
  • Orexin Receptor 2
  • orexin receptor type 2
  • OrexinR2
  • OX2R
  • Ox-2-R
  • ox2-R

Background

HCRTR2 - hypocretin (orexin) receptor 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB763
Species: Hu, Mu, Rt
Applications: IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF2554
Species: Mu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
AF2364
Species: Hu
Applications: WB, IHC
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
H00003062-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for Orexin R2/HCRTR2 Partial Recombinant Protein (H00003062-Q01)(1)

We have publications tested in 1 confirmed species: Rat.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Rat
(1)
All Species

Review for Orexin R2/HCRTR2 Partial Recombinant Protein (H00003062-Q01) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using H00003062-Q01:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot Orexin R2/HCRTR2 H00003062-Q01
Enlarge
reviewed by:
Anonymous
WB Human 06/08/2011
View

Summary

ApplicationWestern Blot
Sample TestedH00003062-Q01, Sample Amount: 01.025.05 0.1 0.2 ug
SpeciesHuman
Comments"Linear relation for Ox2R monoclonal antibody immuno-recognition of human orexin receptor 2 (Swiss-Prot NP_001517) peptide. Recombinant receptor peptide corresponds to amino acids 1-55 at the N-terminus (MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWRE) tagged with a recombinant glutathione S-transferase (GST) fusion protein with a molecular weight of 35-45 kDa. The amino acid sequence for human orexin receptor 2 sequence is 94% homologous to rat. R squared value, 0.9678. I used the Millipore Snap ID system for blocking, washing and secondary incubations. I listed the secondary antibody dilution as 1:50000 but keep in mind this is 0.25 ug of antibody in 10 ml of blocking buffer. If you are using the Snap ID system then the dilution would be 1:6000 (0.25 ug in 1.5 ml. The transfer system used was BioRad's semi dry at 20 V for 30 min, transfer buffer was BioRad'S TG buffer (20% methanol). Membrane used was PVDF (Thermo Scientific)."

Blocking

Blocking DetailsBuffer: SuperBlock T20 (TBS), proprietary protein formulation in TBS, pH7.4 w/ 0.05% Tween-20 & Kathon, Time/Temp: 3min at 25C

Primary Anitbody

Dilution RatioDilution Ratio: 1:1000, Incubation Dilution Buffer: SuperBlock T20 (TBS), Incubation Time/Temp: overnight at 4C

Secondary Antibody

Secondary DescriptionSecondary Ab: Novus rabbit polyclonal anti-mouse HRP, Secondary Ab Dilution Ratio: 1:50000
Secondary Manufacturer Cat#Novus NB720-H

Details

Detection NotesDetection Method: HRP-West Pico (Thermo Scientific), Exposure Time: 30 seconds, Specific Bands: 35-45 kDa

Comments

Comments"Linear relation for Ox2R monoclonal antibody immuno-recognition of human orexin receptor 2 (Swiss-Prot NP_001517) peptide. Recombinant receptor peptide corresponds to amino acids 1-55 at the N-terminus (MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWRE) tagged with a recombinant glutathione S-transferase (GST) fusion protein with a molecular weight of 35-45 kDa. The amino acid sequence for human orexin receptor 2 sequence is 94% homologous to rat. R squared value, 0.9678. I used the Millipore Snap ID system for blocking, washing and secondary incubations. I listed the secondary antibody dilution as 1:50000 but keep in mind this is 0.25 ug of antibody in 10 ml of blocking buffer. If you are using the Snap ID system then the dilution would be 1:6000 (0.25 ug in 1.5 ml. The transfer system used was BioRad's semi dry at 20 V for 30 min, transfer buffer was BioRad'S TG buffer (20% methanol). Membrane used was PVDF (Thermo Scientific)."

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Orexin R2/HCRTR2 Partial Recombinant Protein (H00003062-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for Orexin R2/HCRTR2 Partial Recombinant Protein (H00003062-Q01)

Discover related pathways, diseases and genes to Orexin R2/HCRTR2 Partial Recombinant Protein (H00003062-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Orexin R2/HCRTR2 Partial Recombinant Protein (H00003062-Q01)

Discover more about diseases related to Orexin R2/HCRTR2 Partial Recombinant Protein (H00003062-Q01).
 

Pathways for Orexin R2/HCRTR2 Partial Recombinant Protein (H00003062-Q01)

View related products by pathway.

PTMs for Orexin R2/HCRTR2 Partial Recombinant Protein (H00003062-Q01)

Learn more about PTMs related to Orexin R2/HCRTR2 Partial Recombinant Protein (H00003062-Q01).
 

Research Areas for Orexin R2/HCRTR2 Partial Recombinant Protein (H00003062-Q01)

Find related products by research area.

Blogs on Orexin R2/HCRTR2

There are no specific blogs for Orexin R2/HCRTR2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
06/08/2011
Application: WB
Species: Human

Bioinformatics

Gene Symbol HCRTR2