Orexin R2/HCRTR2 Antibody - BSA Free

Immunohistochemistry-Paraffin: Orexin R2/HCRTR2 Antibody [NBP2-33718] - staining of human lateral ventricle shows distinct positivity in neuropil.S

Product Discontinued

Orexin R2/HCRTR2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: WCRQIPGTSSVVQRKWKPLQPVSQPRGPGQPTKSRMSAVAAEIKQIRARRK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HCRTR2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (86%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Orexin R2/HCRTR2 Antibody - BSA Free

• HCRTR2
• hypocretin (orexin) receptor 2
• Hypocretin receptor type 2
• Orexin R2
• Orexin Receptor 2
• orexin receptor type 2
• OrexinR2
• OX2R
• Ox-2-R
• ox2-R

Background

HCRTR2 is a G-protein coupled receptor expressed exclusively in the brain. It has 64% identity with HCRTR1. HCRTR2 binds both orexin A and orexin B neuropeptides. HCRTR2 is involved in the central feedback mechanism that regulates feeding behaviour.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HCRTR2
• Uniprot:
  • O43614(Human)