ODF2L Antibody

Images

 
Immunohistochemistry-Paraffin: ODF2L Antibody [NBP1-82921] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ODF2L Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SVKVVHERLQIQIHKREAENDKLKEYVKSLETKIAKWNLQSRMNKNEAIVMKEASRQKTVALKKASKVYKQRLDHFTGAIE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ODF2L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ODF2L Protein (NBP1-82921PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ODF2L Antibody

  • dJ977L11.1
  • KIAA1229RP5-977L11.1
  • MGC111060
  • outer dense fiber of sperm tails 2-like
  • outer dense fiber protein 2-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80054
Species: Hu
Applications: WB, IHC
NBP2-03109
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00004957-M01
Species: Hu, Ce
Applications: WB, ELISA, ICC/IF, IHC
NBP1-82921
Species: Hu
Applications: IHC, IHC-P

Publications for ODF2L Antibody (NBP1-82921) (0)

There are no publications for ODF2L Antibody (NBP1-82921).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ODF2L Antibody (NBP1-82921) (0)

There are no reviews for ODF2L Antibody (NBP1-82921). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ODF2L Antibody (NBP1-82921) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ODF2L Products

Bioinformatics Tool for ODF2L Antibody (NBP1-82921)

Discover related pathways, diseases and genes to ODF2L Antibody (NBP1-82921). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ODF2L Antibody (NBP1-82921)

Discover more about diseases related to ODF2L Antibody (NBP1-82921).
 

Pathways for ODF2L Antibody (NBP1-82921)

View related products by pathway.

Blogs on ODF2L

There are no specific blogs for ODF2L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ODF2L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ODF2L