OCIAD2 Antibody

Immunohistochemistry-Paraffin: OCIAD2 Antibody [NBP1-82683] - Staining in human kidney and skeletal muscle tissues using anti-OCIAD2 antibody. Corresponding OCIAD2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: OCIAD2 Antibody [NBP1-82683] - Staining of human kidney, liver, skeletal muscle and stomach using Anti-OCIAD2 antibody NBP1-82683 (A) shows similar protein distribution across tissues to independent antibody NBP1-82682 (B).

Western Blot: OCIAD2 Antibody [NBP1-82683] - Analysis in human cell lines U-251MG and Caco-2. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.

Immunocytochemistry/Immunofluorescence: OCIAD2 Antibody [NBP1-82683] - Staining of human cell line U-251 MG shows localization to mitochondria. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: OCIAD2 Antibody [NBP1-82683] - Immunohistochemical staining of human skeletal muscle shows low expression as expected.

Immunohistochemistry-Paraffin: OCIAD2 Antibody [NBP1-82683] - Staining of human kidney shows high expression.

Immunohistochemistry-Paraffin: OCIAD2 Antibody [NBP1-82683] - Staining of human liver.

Immunohistochemistry-Paraffin: OCIAD2 Antibody [NBP1-82683] - Staining of human stomach.

Immunohistochemistry-Paraffin: OCIAD2 Antibody [NBP1-82683] - Staining of human kidney using Anti-OCIAD2 antibody NBP1-82683.

Immunohistochemistry-Paraffin: OCIAD2 Antibody [NBP1-82683] - Staining of human skeletal muscle using Anti-OCIAD2 antibody NBP1-82683.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

OCIAD2 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GVCQSKFHFFEDQLRGAGFGPQHNRHCLLTCEECKIKHGLSEKGDSQPSAS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: OCIAD2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  OCIAD2 Protein (NBP1-82683PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for OCIAD2 Antibody

• MGC45416
• OCIA domain containing 2
• OCIA domain-containing protein 2
• ovarian carcinoma immunoreactive antigen
• ovarian carcinoma immunoreactive antigen-like protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: OCIAD2