OCIAD2 Antibody - BSA Free

Western Blot: OCIAD2 Antibody [NBP1-82683] - Analysis in human cell lines U-251MG and Caco-2. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.

Immunocytochemistry/Immunofluorescence: OCIAD2 Antibody [NBP1-82683] - Staining of human cell line U-251 MG shows localization to mitochondria. Antibody staining is shown in green.

Analysis in human kidney and skeletal muscle tissues. Corresponding RNA-seq data are presented for the same tissues.

Staining of human skeletal muscle shows no positivity in myocytes as expected.

Staining of human small intestine shows strong granular cytoplasmic positivity in glandular cells.

Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

Staining of human endometrium shows strong granular cytoplasmic positivity in glandular cells.

Staining of human endometrium, kidney, skeletal muscle and upper gastrointestinal HPA040979 (A) shows similar protein distribution across tissues to independent antibody HPA041090 (B).

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

OCIAD2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GVCQSKFHFFEDQLRGAGFGPQHNRHCLLTCEECKIKHGLSEKGDSQPSAS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: OCIAD2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  OCIAD2 Protein (NBP1-82683PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for OCIAD2 Antibody - BSA Free

• MGC45416
• OCIA domain containing 2
• OCIA domain-containing protein 2
• ovarian carcinoma immunoreactive antigen
• ovarian carcinoma immunoreactive antigen-like protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: OCIAD2