Recombinant Human NPHP4 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human NPHP4 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 81 of Human NPHP4 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MCGAFSTQAGAVEKTLFDISPAPGAPVGMLGEDPPVHVRCSDPNVICETQNVGPGEPRDIFLKVASGPSPEIKDFFVIIYS

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
NPHP4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
34.9 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NPHP4 Protein

  • FLJ46306
  • KIAA0673nephrocystin-4
  • nephrocystin 4
  • nephronophthisis 4
  • Nephroretinin
  • POC10 centriolar protein homolog
  • POC10
  • SLSN4nephroretinin

Background

This gene encodes a protein which contains a proline-rich region. The encoded protein may function in renal tubular development and function. This protein interacts with nephrocystin. Mutations in this gene are associated with nephronophthisis type 4. Multiple alternative transcript variants have been described but their full-length nature has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59110
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB
H00027130-P02
Species: Hu
NBP1-84403
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13249
Species: Hu
Applications: IHC, IHC-P
NBP1-83543
Species: Hu
Applications: IHC, IHC-P
NBP1-84412
Species: Hu
Applications: IHC, IHC-P
NBP2-14126
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-86991
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NBP1-88691
Species: Hu
Applications: WB, IHC, IHC-P
MAB5175
Species: Mu
Applications: WB, IHC
NBP1-92123
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15309
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82539
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-59679
Species: Hu, Mu, Rt, Bv, Eq, GP, Rb
Applications: WB, IHC
NBP2-67627
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003000-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
NB300-953
Species: Hu
Applications: WB, Flow, IHC, IHC-P, PEP-ELISA
H00001069-M01
Species: Hu
Applications: WB, ELISA
NB100-77417
Species: Hu, Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, In vivo, CyTOF-ready
H00261734-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for NPHP4 Recombinant Protein (H00261734-P01) (0)

There are no publications for NPHP4 Recombinant Protein (H00261734-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NPHP4 Recombinant Protein (H00261734-P01) (0)

There are no reviews for NPHP4 Recombinant Protein (H00261734-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NPHP4 Recombinant Protein (H00261734-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional NPHP4 Products

Array H00261734-P01

Bioinformatics Tool for NPHP4 Recombinant Protein (H00261734-P01)

Discover related pathways, diseases and genes to NPHP4 Recombinant Protein (H00261734-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NPHP4 Recombinant Protein (H00261734-P01)

Discover more about diseases related to NPHP4 Recombinant Protein (H00261734-P01).
 

Pathways for NPHP4 Recombinant Protein (H00261734-P01)

View related products by pathway.

PTMs for NPHP4 Recombinant Protein (H00261734-P01)

Learn more about PTMs related to NPHP4 Recombinant Protein (H00261734-P01).

Blogs on NPHP4

There are no specific blogs for NPHP4, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NPHP4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NPHP4