Nicotinic Acetylcholine R alpha 3/CHRNA3 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

Nicotinic Acetylcholine R alpha 3/CHRNA3 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CHRNA3.
  
  

  Source: E. coli

  Amino Acid Sequence: RTPTTHTMPSWVKTVFLNLLPRVMFMTRPTSNEGNAQKPRPLYGAELSNLNCFSRAESKGCKEGYPCQDGMCGYCHHRRIKISNFSANLTRSSSSESVDAVLSLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQDDWKYVAM

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: CHRNA3
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87534.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 34 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Nicotinic Acetylcholine R alpha 3/CHRNA3 Recombinant Protein Antigen

• cholinergic receptor, nicotinic, alpha 3
• cholinergic receptor, nicotinic, alpha polypeptide 3
• CHRNA3
• LNCR2
• MGC104879
• NACHRA3
• neuronal acetylcholine receptor subunit alpha-3
• neuronal nicotinic acetylcholine receptor, alpha3 subunit
• Nicotinic Acetylcholine R alpha 3
• Nicotinic Acetylcholine Ra3
• PAOD2

Background

The nicotinic acetylcholine receptor (nAChR) is a ligand gated ion channel that mediates neurotransmission at the neuromuscular junction, autonomic ganglia and at some sites in the central nervous system. Distinct nAChR subtypes exist that can be stimulated by the neurotransmitter acetylcholine, the natural product nicotine, or by synthetic compounds. After binding acetylcholine, Nicotinic Acetylcholine Receptor alpha 3 responds by an extensive change in conformation that affects all subunits and leads to opening of an ion conducting channel across the plasma membrane.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

FAQs for Nicotinic Acetylcholine R alpha 3/CHRNA3 Protein (NBP1-87534PEP). (Showing 1 - 1 of 1 FAQ).

1. I am looking to buy antibodies against most of the nicotinic receptor subunits for WB and IHC application. Could you please indicate which of your antibodies have been used by other researchers and provide publications showing their use? Thanks.
   • A list of our antibodies directed against he nicotinic acetylcholine receptors can be found here. Any products with publications will be indicated on the search page and can be found under the publications tab on the individual product's datasheet. Furthermore, we guarantee all of our products for the applications and species list on the datasheet. This should help narrow down your search.

Bioinformatics

• Gene Symbol: CHRNA3