Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody

Images

 
Immunohistochemistry: Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody [NBP1-87534] - Staining of human fallopian tube shows strong membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RTPTTHTMPSWVKTVFLNLLPRVMFMTRPTSNEGNAQKPRPLYGAELSNLNCFSRAESKGCKEGYPCQDGMCGYCHHRRIKISNFSANLTRSSSSESVDAVLSLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQDDWKYVAM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHRNA3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Nicotinic Acetylcholine R alpha 3/CHRNA3 Protein (NBP1-87534PEP)
Publications
Read Publication using
NBP1-87534 in the following applications:

  • IHC
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody

  • cholinergic receptor, nicotinic, alpha 3
  • cholinergic receptor, nicotinic, alpha polypeptide 3
  • CHRNA3
  • LNCR2
  • MGC104879
  • NACHRA3
  • neuronal acetylcholine receptor subunit alpha-3
  • neuronal nicotinic acetylcholine receptor, alpha3 subunit
  • Nicotinic Acetylcholine R alpha 3
  • Nicotinic Acetylcholine Ra3
  • PAOD2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-69122
Species: Hu
Applications: WB
NBP2-60788
Species: Mu, Rt
Applications: WB, ICC/IF
NB100-1798
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P, GS
NBP2-01437
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, IHC, IHC-P
NBP2-57262
Species: Hu
Applications: ICC/IF
NBP1-28467
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NBP1-85487
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00001142-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-01608
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC, IHC-P
H00064399-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP1-31386
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-55967
Species: Hu
Applications: ICC/IF
NBP1-79948
Species: Hu, Rt
Applications: WB
NBP1-89333
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody (NBP1-87534)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody (NBP1-87534) (0)

There are no reviews for Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody (NBP1-87534). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody (NBP1-87534). (Showing 1 - 1 of 1 FAQ).

  1. I am looking to buy antibodies against most of the nicotinic receptor subunits for WB and IHC application. Could you please indicate which of your antibodies have been used by other researchers and provide publications showing their use? Thanks.
    • A list of our antibodies directed against he nicotinic acetylcholine receptors can be found here. Any products with publications will be indicated on the search page and can be found under the publications tab on the individual product's datasheet. Furthermore, we guarantee all of our products for the applications and species list on the datasheet. This should help narrow down your search.

Secondary Antibodies

 

Isotype Controls

Additional Nicotinic Acetylcholine R alpha 3/CHRNA3 Products

Bioinformatics Tool for Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody (NBP1-87534)

Discover related pathways, diseases and genes to Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody (NBP1-87534). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody (NBP1-87534)

Discover more about diseases related to Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody (NBP1-87534).
 

Pathways for Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody (NBP1-87534)

View related products by pathway.

PTMs for Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody (NBP1-87534)

Learn more about PTMs related to Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody (NBP1-87534).

Blogs on Nicotinic Acetylcholine R alpha 3/CHRNA3

There are no specific blogs for Nicotinic Acetylcholine R alpha 3/CHRNA3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CHRNA3
Entrez