Immunohistochemistry-Paraffin: Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody [NBP1-87534] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuropil.
Immunohistochemistry-Paraffin: Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody [NBP1-87534] - Staining of human gastrointestinal shows weak membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody [NBP1-87534] - Staining of human fallopian tube shows strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody [NBP1-87534] - Staining of human kidney shows weak to moderate membranous positivity in cells in glomeruli and tubules.
Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!
Or feel free to contact us for alternative products.
Datasheet
Reviews & Publications
Protocols & FAQs
Support & Research
Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody Summary
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RTPTTHTMPSWVKTVFLNLLPRVMFMTRPTSNEGNAQKPRPLYGAELSNLNCFSRAESKGCKEGYPCQDGMCGYCHHRRIKISNFSANLTRSSSSESVDAVLSLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQDDWKYVAM
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHRNA3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
The nicotinic acetylcholine receptor (nAChR) is a ligand gated ion channel that mediates neurotransmission at the neuromuscular junction, autonomic ganglia and at some sites in the central nervous system. Distinct nAChR subtypes exist that can be stimulated by the neurotransmitter acetylcholine, the natural product nicotine, or by synthetic compounds. After binding acetylcholine, Nicotinic Acetylcholine Receptor alpha 3 responds by an extensive change in conformation that affects all subunits and leads to opening of an ion conducting channel across the plasma membrane.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Reviews for Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody (NBP1-87534) (0)
There are no reviews for Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody (NBP1-87534).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody (NBP1-87534). (Showing 1 - 1 of 1 FAQ).
I am looking to buy antibodies against most of the nicotinic receptor subunits for WB and IHC application. Could you please indicate which of your antibodies have been used by other researchers and provide publications showing their use? Thanks.
A list of our antibodies directed against he nicotinic acetylcholine receptors can be found here. Any products with publications will be indicated on the search page and can be found under the publications tab on the individual product's datasheet. Furthermore, we guarantee all of our products for the applications and species list on the datasheet. This should help narrow down your search.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody and receive a gift card or discount.