Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody

Immunohistochemistry-Paraffin: Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody [NBP1-87534] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuropil.

Immunohistochemistry-Paraffin: Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody [NBP1-87534] - Staining of human gastrointestinal shows weak membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody [NBP1-87534] - Staining of human fallopian tube shows strong membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody [NBP1-87534] - Staining of human kidney shows weak to moderate membranous positivity in cells in glomeruli and tubules.

• Reactivity: Hu, Mu, Rt
• Applications: IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RTPTTHTMPSWVKTVFLNLLPRVMFMTRPTSNEGNAQKPRPLYGAELSNLNCFSRAESKGCKEGYPCQDGMCGYCHHRRIKISNFSANLTRSSSSESVDAVLSLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQDDWKYVAM
• Specificity: Specificity of human Nicotinic Acetylcholine R alpha 3/CHRNA3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Predicted Species: Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CHRNA3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: IHC reported in scientific literature (PMID: 24880216). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Nicotinic Acetylcholine R alpha 3/CHRNA3 Protein (NBP1-87534PEP)

Reactivity Notes

Reactivity reported for mouse in scientific literature (PMID: 24880216).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody

• cholinergic receptor, nicotinic, alpha 3
• cholinergic receptor, nicotinic, alpha polypeptide 3
• CHRNA3
• LNCR2
• MGC104879
• NACHRA3
• neuronal acetylcholine receptor subunit alpha-3
• neuronal nicotinic acetylcholine receptor, alpha3 subunit
• Nicotinic Acetylcholine R alpha 3
• Nicotinic Acetylcholine Ra3
• PAOD2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody (NBP1-87534)(1)

Publication using NBP1-87534

• Paez-Gonzalez Patricia, Asrican Brent, Rodriguez Erica, Kuo Chay T. Identification of distinct ChAT(+) neurons and activity-dependent control of postnatal SVZ neurogenesis. Nat Neurosci. 2014 Jun 01 [PMID: 24880216] (IHC, Mouse)

FAQs for Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody (NBP1-87534). (Showing 1 - 1 of 1 FAQ).

1. I am looking to buy antibodies against most of the nicotinic receptor subunits for WB and IHC application. Could you please indicate which of your antibodies have been used by other researchers and provide publications showing their use? Thanks.
   • A list of our antibodies directed against he nicotinic acetylcholine receptors can be found here. Any products with publications will be indicated on the search page and can be found under the publications tab on the individual product's datasheet. Furthermore, we guarantee all of our products for the applications and species list on the datasheet. This should help narrow down your search.

Bioinformatics

• Gene Symbol: CHRNA3