Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody

Images

 
Immunohistochemistry-Paraffin: Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody [NBP1-87534] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuropil.
Immunohistochemistry-Paraffin: Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody [NBP1-87534] - Staining of human gastrointestinal shows weak membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody [NBP1-87534] - Staining of human fallopian tube shows strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody [NBP1-87534] - Staining of human kidney shows weak to moderate membranous positivity in cells in glomeruli and tubules.

Order Details


    • Catalog Number
      NBP1-87534
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RTPTTHTMPSWVKTVFLNLLPRVMFMTRPTSNEGNAQKPRPLYGAELSNLNCFSRAESKGCKEGYPCQDGMCGYCHHRRIKISNFSANLTRSSSSESVDAVLSLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQDDWKYVAM
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHRNA3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
IHC reported in scientific literature (PMID: 24880216). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Nicotinic Acetylcholine R alpha 3/CHRNA3 Protein (NBP1-87534PEP)
Publications
Read Publication using
NBP1-87534 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 24880216).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody

  • cholinergic receptor, nicotinic, alpha 3
  • cholinergic receptor, nicotinic, alpha polypeptide 3
  • CHRNA3
  • LNCR2
  • MGC104879
  • NACHRA3
  • neuronal acetylcholine receptor subunit alpha-3
  • neuronal nicotinic acetylcholine receptor, alpha3 subunit
  • Nicotinic Acetylcholine R alpha 3
  • Nicotinic Acetylcholine Ra3
  • PAOD2

Background

The nicotinic acetylcholine receptor (nAChR) is a ligand gated ion channel that mediates neurotransmission at the neuromuscular junction, autonomic ganglia and at some sites in the central nervous system. Distinct nAChR subtypes exist that can be stimulated by the neurotransmitter acetylcholine, the natural product nicotine, or by synthetic compounds. After binding acetylcholine, Nicotinic Acetylcholine Receptor alpha 3 responds by an extensive change in conformation that affects all subunits and leads to opening of an ion conducting channel across the plasma membrane.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-61677
Species: Hu, Rt
Applications: ELISA, Flow, WB
NBP2-61743
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
NBP2-61674
Species: Hu
Applications: ELISA, WB
NB100-1798
Species: Hu, Mu
Applications: GS, GS, ICC/IF, IHC,  IHC-P, WB
NBP2-01437
Species: Hu, Pm, Mu, Pm, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP2-93514
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-28467
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP2-94035
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, WB
H00009455-B01P
Species: Hu, Mu, Rt
Applications: WB
H00001142-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-01608
Species: Hu, Pm, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB
AF1568
Species: Mu
Applications: WB
NBP1-31386
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP3-23927
Species: Hu
Applications:  IHC-P
NBP2-61679
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-61739
Species: Hu
Applications: ELISA, Flow, IHC,  IHC-P, WB
NBP3-35541
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-1780
Species: Hu, Mu
Applications: Flow, PEP-ELISA, WB

Publications for Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody (NBP1-87534)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IF/IHC.


Filter By Application
IF/IHC
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody (NBP1-87534) (0)

There are no reviews for Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody (NBP1-87534). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody (NBP1-87534). (Showing 1 - 1 of 1 FAQ).

  1. I am looking to buy antibodies against most of the nicotinic receptor subunits for WB and IHC application. Could you please indicate which of your antibodies have been used by other researchers and provide publications showing their use? Thanks.
    • A list of our antibodies directed against he nicotinic acetylcholine receptors can be found here. Any products with publications will be indicated on the search page and can be found under the publications tab on the individual product's datasheet. Furthermore, we guarantee all of our products for the applications and species list on the datasheet. This should help narrow down your search.

Secondary Antibodies

 

Isotype Controls

Additional Nicotinic Acetylcholine R alpha 3/CHRNA3 Products

Research Areas for Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody (NBP1-87534)

Find related products by research area.

Blogs on Nicotinic Acetylcholine R alpha 3/CHRNA3

There are no specific blogs for Nicotinic Acetylcholine R alpha 3/CHRNA3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Nicotinic Acetylcholine R alpha 3/CHRNA3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CHRNA3