NCRNA00114 Antibody


Western Blot: NCRNA00114 Antibody [NBP1-70648] - Titration: 0.2-1 ug/ml, Positive Control: Human heart.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

NCRNA00114 Antibody Summary

Synthetic peptides corresponding to NCRNA00114 The peptide sequence was selected from the N terminal of NCRNA00114. Peptide sequence SFSKMRTGWRGAIPLRWRNRARNREKPHSPRAVSSPATHSLPPSNPCRLT.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against NCRNA00114 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NCRNA00114 Antibody

  • C21orf24
  • long intergenic non-protein coding RNA 114
  • NCRNA00114


The specific function of NCRNA00114 is not yet known.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB

Publications for NCRNA00114 Antibody (NBP1-70648) (0)

There are no publications for NCRNA00114 Antibody (NBP1-70648).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NCRNA00114 Antibody (NBP1-70648) (0)

There are no reviews for NCRNA00114 Antibody (NBP1-70648). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NCRNA00114 Antibody (NBP1-70648) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional NCRNA00114 Products

NCRNA00114 NBP1-70648

Bioinformatics Tool for NCRNA00114 Antibody (NBP1-70648)

Discover related pathways, diseases and genes to NCRNA00114 Antibody (NBP1-70648). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on NCRNA00114

There are no specific blogs for NCRNA00114, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NCRNA00114 Antibody and receive a gift card or discount.


Gene Symbol LINC00114