Home » NCOA5 » NCOA5 Proteins » NCOA5 Recombinant Protein Antigen

NCOA5 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for NCOA5 Protein (NBP2-47361PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

NCOA5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NCOA5.

Source: E.coli

Amino Acid Sequence: NECREKEREEIARQAAKMADEAILQERERGGPEEGVRGGHPPAIQSLINLLADNRYLTAEETDKIINYLRERKERLMRSSTDSLPGPISRQPL
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NCOA5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-47361.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for NCOA5 Recombinant Protein Antigen

  • CIAbA465L10.6
  • Coactivator independent of AF-2
  • KIAA1637
  • NCoA-5
  • nuclear receptor coactivator 5

Background

NCOA5 is a nuclear receptor coregulator that can have both coactivator and corepressor functions. It interacts with nuclear receptors for steroids (ESR1 and ESR2) independently of the steroid binding domain (AF-2) of the ESR receptors, and with the orphan nuclear receptor NR1D2. It Is also involved in the coactivation of nuclear steroid receptors (ER) as well as the corepression of MYC/c-myc in response to 17-beta-estradiol (E2).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

TIP30 Antibody
NBP1-88170
Immunohistochemistry-Paraffin: TIP30 Antibody [NBP1-88170] - Staining of human skeletal muscle shows very weak positivity.
Western Blot: TIP30 Antibody [NBP1-88170] - Analysis in control (vector only transfected HEK293T lysate) and HTATIP2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Western Blot: TIP30 Antibody [NBP1-88170] - Analysis in human cell line A-549.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
CD40/TNFRSF5
Antibody (mAb89)
DDX0131P-100
Immunocytochemistry/Immunofluorescence: CD40/TNFRSF5 Antibody (mAb89) [DDX0131P-100] - CD40-transfected L cells stained.
Immunohistochemistry: CD40/TNFRSF5 Antibody (mAb89) [DDX0131P-100] - IHC staining on Bouin paraffinlymph node section. HumanCD40 stained with mAb 89.
(11 Publications)
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
SRC1 Antibody
(1135)
NB200-310
Western Blot: SRC1 Antibody (1135/H4) [NB200-310] - Mouse tissue (50 ug) was separated by 5% SDS-PAGE, and the membrane was blotted with SRC1 antibody [1135] diluted at 1:2000.
(1 Review)
(4 Publications)
Species: Hu, Pm, Mu, Rt
Applications: ChIP, IP, WB
Rev-erb beta/NR1D2
Antibody (1G2)
H00009975-M01
Immunocytochemistry/Immunofluorescence: Rev-erb beta/NR1D2 Antibody (1G2) [H00009975-M01] - Analysis of monoclonal antibody to NR1D2 on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: Rev-erb beta/NR1D2 Antibody (1G2) [H00009975-M01] - Analysis of NR1D2 over-expressed 293 cell line, cotransfected with NR1D2 Validated Chimera RNAi ( Cat # H00009975-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with NR1D2 monoclonal antibody (M01), clone 1G2 (Cat # H00009975-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot: Rev-erb beta/NR1D2 Antibody (1G2) [H00009975-M01] - Analysis of NR1D2 expression in transfected 293T cell line by NR1D2 monoclonal antibody (M01), clone 1G2.Lane 1: NR1D2 transfected lysate(64.7 KDa).Lane 2: Non-transfected lysate.
Species: Hu
Applications: ELISA, ICC/IF, KD, WB
ER alpha/NR3A1
Antibody (33)
NB300-560
Western Blot: ER alpha/NR3A1 Antibody (33) [NB300-560] - Analysis of recombinant ER alpha.
Immunohistochemistry-Frozen: ER alpha/NR3A1 Antibody (33) [NB300-560] - Human breast carcinoma (B) and magnified section (C) compared with an isotype control (A).
Immunohistochemistry-Paraffin: ER alpha/NR3A1 Antibody (33) [NB300-560] - Human breast tissue (B) and magnified section (C) compared with an isotype control (A).
(1 Review)
(8 Publications)
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
Rev-erb A
alpha/NR1D1 Antibody
H00009572-M02
Western Blot: Rev-erb A alpha/NR1D1 Antibody (4F6) [H00009572-M02] - NR1D1 monoclonal antibody (M02), clone 4F6. Analysis of NR1D1 expression in NIH/3T3.
Immunohistochemistry-Paraffin: Rev-erb A alpha/NR1D1 Antibody (4F6) [H00009572-M02] - Representative tissue microarray specimens stained for NR1D1. Immunoreactivity of representative tumor specimens is shown. Low and high NR1D1 expression groups are defined in methods. The low NR1D1 expression ranges from immunoreactive scores 2 to 6 (left (P2xI1), middle (P3xI1), and right (P3xI2)), and the high NR1D1 expression shows immunoreactive score 12 (all, P4xI3). Image collected and cropped by CiteAb from the following publication (https://breast-cancer-research.biomedcentral.com/articles/10.1186/s13058-019-1197-x) licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: Rev-erb A alpha/NR1D1 Antibody (4F6) [H00009572-M02] - analysis of NR1D1 in paraffin embedded mouse lung tissue using anti-NR1D1 antibody. Image from verified customer review.
(4 Reviews)
(6 Publications)
Species: Hu, Mu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, KD, WB
c-Myc Antibody
(9E10) - BSA Free
NB600-302
Flow Cytometry: c-Myc Antibody (9E10) [NB600-302] - An intracellular stain was performed on U-937 cells with c-Myc Antibody (9E10) NB600-302AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Flow Cytometry: c-Myc Antibody (9E10) [NB600-302] - An intracellular stain was performed on Jurkat cells with c-Myc Antibody (9E10) NB600-302R (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 550.
Western Blot: c-Myc Antibody (9E10) [NB600-302] - CtIP is phosphorylated by CDKs at multiple sites. Myc-BRCA1 and/or HA-CtIP WT or indicated mutants were expressed in 293T cells and co-immunoprecipitation was performed. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pgen.1003277) licensed under a CC-BY licence.
(4 Reviews)
(38 Publications)
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
Lactoferrin
Antibody (1C6cc)
NB120-10109
CyTOF-ready: Lactoferrin Antibody (1C6) [NB120-10109] - Human bone marrow after RBC lysis, stained with anti-CD16, fixed, permeabilized with methanol, stained with anti-lactoferrin 1C6 NB120-10109 and anti-rRNA Y10b NB100-662, and gated on myeloid cells per Nat Med. 2020. 26:408-417. CyTOF image submitted by a verified customer review.
(1 Review)
(1 Publication)
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IHC-P, S-ELISA, WB
TfR2 Antibody
(353816) [Unconjugate
MAB3120
Simple Western lane view shows lysates of human liver tissue, loaded at 0.2 mg/mL. A specific band was detected for TfR2 at approximately 104 kDa (as indicated) using 10 µg/mL of Mouse Anti-Human TfR2 Monoclonal Antibody (Catalog # MAB3120) . This experiment was conducted under reducing conditions and using the12-230 kDa separation system.Non-specific interaction with the 230 kDa Simple Western standard may be seen with this antibody.
Western blot shows lysates of human liver tissue and K562 human chronic myelogenous leukemia cell line. PVDF membrane was probed with 2 µg/mL of Mouse Anti-Human TfR2 Monoclonal Antibody (Catalog # MAB3120) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for TfR2 at approximately 100 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: Simple Western, WB
TfR (Transferrin
R) Antibody (OX26) - ...
NB200-585
Western Blot: TfR (Transferrin R) Antibody (OX26) [NB200-585] - Total protein from rat adrenal gland cells (PC12) and rat placenta was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2 ug/ml anti-CD71 in 1% milk, and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Flow Cytometry: TfR (Transferrin R) Antibody (OX26) [NB200-585] - Staining of rat spleen cells with mouse anti rat CD71: RPE.
Immunocytochemistry/Immunofluorescence: TfR (Transferrin R) Antibody (OX26) [NB200-585] - PC-12 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton X-100. The cells were incubated with anti TfR/Transferrin R (OX26) NB200-585 at a 1:100 dilution overnight at 4C and detected with an anti-mouse DyLight 488 (green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (red) at a 1:200 dilution. Nuclei were counterstained with DAPI (blue). Cells were imaged using a 40X objective.
(16 Publications)
Species: Mu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB

Publications for NCOA5 Protein (NBP2-47361PEP) (0)

There are no publications for NCOA5 Protein (NBP2-47361PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NCOA5 Protein (NBP2-47361PEP) (0)

There are no reviews for NCOA5 Protein (NBP2-47361PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NCOA5 Protein (NBP2-47361PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NCOA5 Products

Array NBP2-47361PEP

Bioinformatics Tool for NCOA5 Protein (NBP2-47361PEP)

Discover related pathways, diseases and genes to NCOA5 Protein (NBP2-47361PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NCOA5 Protein (NBP2-47361PEP)

Discover more about diseases related to NCOA5 Protein (NBP2-47361PEP).
 

Pathways for NCOA5 Protein (NBP2-47361PEP)

View related products by pathway.

Blogs on NCOA5

There are no specific blogs for NCOA5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Flow Cytometry: c-Myc Antibody (9E10) [NB600-302] - An intracellular stain was performed on U-937 cells with c-Myc Antibody (9E10) NB600-302AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
c-Myc Antibody (9E10) - BSA Free
NB600-302

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NCOA5 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol NCOA5