Home » NCOA5 » NCOA5 Proteins » NCOA5 Recombinant Protein Antigen

NCOA5 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for NCOA5 Protein (NBP2-47361PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

NCOA5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NCOA5.

Source: E.coli

Amino Acid Sequence: NECREKEREEIARQAAKMADEAILQERERGGPEEGVRGGHPPAIQSLINLLADNRYLTAEETDKIINYLRERKERLMRSSTDSLPGPISRQPL
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NCOA5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-47361.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for NCOA5 Recombinant Protein Antigen

  • CIAbA465L10.6
  • Coactivator independent of AF-2
  • KIAA1637
  • NCoA-5
  • nuclear receptor coactivator 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

TIP30 Antibody
NBP2-20646
Western Blot: TIP30 Antibody [NBP2-20646] - Sample (30 ug of whole cell lysate) A: A431 B: HeLa 12% SDS PAGE gel, diluted at 1:5000.
Immunocytochemistry/Immunofluorescence: TIP30 Antibody [NBP2-20646] - Confocal immunofluorescence analysis of paraformaldehyde-fixed HeLa, using TIP30 antibody (Green) at 1:500 dilution. Alpha-tubulin filaments are labeled with Alpha-tubulin antibody (Red) at 1:2000.
Immunohistochemistry-Paraffin: TIP30 Antibody [NBP2-20646] - Paraffin-embedded gastric cancer. TIP30 antibody dilution: 1:500.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
CD40/TNFRSF5
Antibody (mAb89)
DDX0131P-100
Immunocytochemistry/Immunofluorescence: CD40/TNFRSF5 Antibody (mAb89) [DDX0131P-100] - CD40-transfected L cells stained.
Immunohistochemistry: CD40/TNFRSF5 Antibody (mAb89) [DDX0131P-100] - IHC staining on Bouin paraffinlymph node section. HumanCD40 stained with mAb 89.
(11 Publications)
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
SRC1 Antibody
(1135)
NB200-310
Western Blot: SRC1 Antibody (1135/H4) [NB200-310] - Mouse tissue (50 ug) was separated by 5% SDS-PAGE, and the membrane was blotted with SRC1 antibody [1135] diluted at 1:2000.
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, IP
Rev-erb beta/NR1D2
Antibody
NLS2459
Immunohistochemistry-Paraffin: TR alpha/NR1A1/Thyroid Hormone Receptor alpha Antibody [NLS2459] - Anti-NR1D2 antibody IHC of human Skin, Melanoma. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Immunohistochemistry-Paraffin: TR alpha/NR1A1/Thyroid Hormone Receptor alpha Antibody [NLS2459] - Analysis of anti-NR1D2 antibody with human brain, cerebellum.
Species: Hu, Bt, Bv, Ca, Eq, Pm, Pm, Rb
Applications: IHC, IHC-P
ER alpha/NR3A1
Antibody (6A6E8)
NBP2-61764
Western Blot: ER alpha/NR3A1 Antibody (6A6E8) [NBP2-61764] - Analysis using ESR1 mAb against HEK293 (1) and ESR1 (AA: 2-185)-hIgGFc transfected HEK293 (2) cell lysate.
Immunocytochemistry/Immunofluorescence: ER alpha/NR3A1 Antibody (6A6E8) [NBP2-61764] - Analysis of Hela cells using ESR1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor- 555 phalloidin. Goat anti-Mouse IgG (H+L) DyLight 488 secondary antibody was used.
Immunohistochemistry-Paraffin: ER alpha/NR3A1 Antibody (6A6E8) [NBP2-61764] - Analysis of esophageal cancer tissues using ESR1 mouse mAb with DAB staining.
Species: Hu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Rev-erb A
alpha/NR1D1 Antibody
H00009572-M02
Western Blot: Rev-erb A alpha/NR1D1 Antibody (4F6) [H00009572-M02] - NR1D1 monoclonal antibody (M02), clone 4F6 Analysis of NR1D1 expression in Hela S3 NE.
Immunocytochemistry/Immunofluorescence: Rev-erb A alpha/NR1D1 Antibody (4F6) [H00009572-M02] - Analysis of monoclonal antibody to NR1D1 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: Rev-erb A alpha/NR1D1 Antibody (4F6) [H00009572-M02] - Analysis of monoclonal antibody to NR1D1 on formalin-fixed paraffin-embedded human kidney. Antibody concentration 3 ug/ml.
(4 Reviews)
(4 Publications)
Species: Hu, Mu
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, RNAi, S-ELISA
c-Myc Antibody
(9E10)
NB600-302
Western Blot: c-Myc Antibody (9E10) [NB600-302] - CtIP is phosphorylated by CDKs at multiple sites. Myc-BRCA1 and/or HA-CtIP WT or indicated mutants were expressed in 293T cells and co-immunoprecipitation was performed. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pgen.1003277) licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: c-Myc Antibody (9E10) [NB600-302] - c-Myc was detected in immersion fixed paraffin-embedded sections of human breast cancer using anti-human mouse monoclonal antibody (Catalog # NB600-302, clone 9E10) at 1:50 dilution overnight at 4 C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue). Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
Simple Western: c-Myc Antibody (9E10) [NB600-302] - Simple Western lane view shows a specific band for c-Myc in 0.5 mg/ml of Jurkat lysate. This experiment as performed under reducing conditions using the 12-230 kDa separation system.
(4 Reviews)
(31 Publications)
Species: Hu, Mu, Dr
Applications: WB, Simple Western, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Lactoferrin
Antibody (1C6)
NB120-10109
CyTOF-ready: Lactoferrin Antibody (1C6) [NB120-10109] - Human bone marrow after RBC lysis, stained with anti-CD16, fixed, permeabilized with methanol, stained with anti-lactoferrin 1C6 NB120-10109 and anti-rRNA Y10b NB100-662, and gated on myeloid cells per Nat Med. 2020. 26:408-417. CyTOF image submitted by a verified customer review.
(1 Review)
(1 Publication)
Species: Hu
Applications: WB, Flow, IHC, IHC-P, S-ELISA, CyTOF-ready
TfR2 Antibody
(353816) [Unconjugate
MAB3120
Western blot shows lysates of human liver tissue and K562 human chronic myelogenous leukemia cell line. PVDF membrane was probed with 2 µg/mL of Mouse Anti-Human TfR2 Monoclonal Antibody (Catalog # MAB3120) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for TfR2 at approximately 100 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of human liver tissue, loaded at 0.2 mg/mL. A specific band was detected for TfR2 at approximately 104 kDa (as indicated) using 10 µg/mL of Mouse Anti-Human TfR2 Monoclonal Antibody (Catalog # MAB3120). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.Non-specific interaction with the 230 kDa Simple Western standard may be seen with this antibody.
Species: Hu
Applications: WB, Simple Western
TfR (Transferrin
R) Antibody (OX26)
NB200-585
Western Blot: TfR (Transferrin R) Antibody (OX26) [NB200-585] - Total protein from rat adrenal gland cells (PC12) and rat placenta was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2 ug/ml anti-CD71 in 1% milk, and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: TfR (Transferrin R) Antibody (OX26) [NB200-585] - PC-12 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton X-100. The cells were incubated with anti TfR/Transferrin R (OX26) NB200-585 at a 1:100 dilution overnight at 4C and detected with an anti-mouse DyLight 488 (green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (red) at a 1:200 dilution. Nuclei were counterstained with DAPI (blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: TfR (Transferrin R) Antibody (OX26) [NB200-585] - Analysis of FFPE mouse spleen using TfR (OX26) antibody at 1:50 on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images was performed using Aperio AT2 (Leica Biosystems). Plasma membrane staining was observed. Staining was performed by Histowiz.
(15 Publications)
Species: Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC

Publications for NCOA5 Protein (NBP2-47361PEP) (0)

There are no publications for NCOA5 Protein (NBP2-47361PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NCOA5 Protein (NBP2-47361PEP) (0)

There are no reviews for NCOA5 Protein (NBP2-47361PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NCOA5 Protein (NBP2-47361PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Learn about Custom Antibody Labeling

Additional NCOA5 Products

Array NBP2-47361PEP

Bioinformatics Tool for NCOA5 Protein (NBP2-47361PEP)

Discover related pathways, diseases and genes to NCOA5 Protein (NBP2-47361PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NCOA5 Protein (NBP2-47361PEP)

Discover more about diseases related to NCOA5 Protein (NBP2-47361PEP).
 

Pathways for NCOA5 Protein (NBP2-47361PEP)

View related products by pathway.

Blogs on NCOA5

There are no specific blogs for NCOA5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Western Blot: c-Myc Antibody (9E10) [NB600-302] - CtIP is phosphorylated by CDKs at multiple sites. Myc-BRCA1 and/or HA-CtIP WT or indicated mutants were expressed in 293T cells and co-immunoprecipitation was performed. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pgen.1003277) licensed under a CC-BY licence.
c-Myc Antibody (9E10)
NB600-302

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NCOA5 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol NCOA5