NAT8L Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: NAT8L Antibody [NBP1-83479] - Staining of human cell line HEK 293 shows localization to mitochondria. Antibody staining is shown in green.

Product Discontinued

NAT8L Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:MADIEQYYMKPPGSCFWVAVLDGNVVGIVAARAHEEDNTVELLRMSVDSRFRGKGIAKALGRKVLE
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NAT8L
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NAT8L Antibody - BSA Free

• Camello-like protein 3
• CML3
• DKFZp434B0650
• DKFZp566H184
• EC 2.3.1.17
• FLJ37478
• Hcml3
• MGC117272
• NAA synthetase
• N-acetyltransferase 8-like (GCN5-related, putative)
• N-acetyltransferase 8-like protein
• N-acetyltransferase 8-like
• NAT8-LIKE

Background

N-Acetyltransferase 8-Like, NAT8L, is a single-pass membrane protein and a member of the N-Acetyltransferase superfamily. The protein catalyzes the synthesis of N-acetylaspartate (NAA), a major transport and storage enzyme that is specific to the nervous system. Mutations in NAT8L result in primary NAA deficiency.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NAT8L