NAT11 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: NAT11 Antibody [NBP1-92168] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear bodies.

Immunohistochemistry-Paraffin: NAT11 Antibody [NBP1-92168] - Staining of human lymph node shows no positivity in germinal center cells as expected.

Immunohistochemistry-Paraffin: NAT11 Antibody [NBP1-92168] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.

Immunohistochemistry-Paraffin: NAT11 Antibody [NBP1-92168] - Staining of human heart muscle shows moderate ctyoplasmic positivity in cardiomyocytes.

Immunohistochemistry-Paraffin: NAT11 Antibody [NBP1-92168] - Staining of human skeletal muscle shows strong ctyoplasmic positivity in myocytes.

Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.

Staining of human heart muscle shows moderate cytoplasmic positivity in cardiomyocytes.

Staining of human lymph node shows no positivity in germinal center cells as expected.

Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NAT11 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DLTKTNMQTMYEQSEWGWKDREKREEMTDDRAWYLIAWENSSVPVAFSHFRFDVECGDEVLYCYEVQLESKV
• Predicted Species: Mouse (99%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NAA40
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  NAT11 Protein (NBP1-92168PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NAT11 Antibody - BSA Free

• EC 2.3.1.-
• FLJ13848
• N(alpha)-acetyltransferase 40, NatD catalytic subunit, homolog (S. cerevisiae)
• N-acetyltransferase 11 (GCN5-related, putative)
• N-acetyltransferase 11
• N-alpha-acetyltransferase 40, NatD catalytic subunit
• NAT11
• PATT1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NAA40