MYO15A Recombinant Protein Antigen

Images

 
There are currently no images for MYO15A Recombinant Protein Antigen (NBP2-69069PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MYO15A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MYO15A.

Source: E.coli

Amino Acid Sequence: LHPHLTRFLQDVSRTPGLPFQGIAKACEQNLQKTLRFGGRLELPSSIELRAMLAGRSSKRQLFLLPGGLERHLKIKTCTVALDVVEEICAEMA

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MYO15A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-69069. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for MYO15A Recombinant Protein Antigen

  • DFNB3
  • DKFZp686N18198
  • FLJ17274
  • FLJ31311
  • MYO15
  • myosin XVA
  • myosin-XV
  • Unconventional myosin-15

Background

The MYO15A gene encodes an unconventional myosin. This protein differs from other myosins in that it has a long N-terminal extension preceding the conserved motor domain. Studies in mice suggest that this protein is necessary for actin organization in the hair

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-93677
Species: Hu, Mu, Rt
Applications: WB
H00025861-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-41304
Species: Hu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
H00004646-M02
Species: Hu, Mu
Applications: ELISA, IHC, S-ELISA, WB
NBP1-85237
Species: Hu
Applications: IHC, IHC-Fr, IHC-P
NBP3-03833
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-46574
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
MAB4470
Species: All-Multi
Applications: ICC, IHC, WB
H00053904-P01
Species: Hu
Applications: ELISA, AP, PA, WB
H00002035-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
H00007007-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP3-05608
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-90588
Species: Hu, Rt
Applications: IHC, IHC-P, Simple Western, WB
NBP1-47791
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
NBP2-00594
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP2-94064
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for MYO15A Recombinant Protein Antigen (NBP2-69069PEP) (0)

There are no publications for MYO15A Recombinant Protein Antigen (NBP2-69069PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MYO15A Recombinant Protein Antigen (NBP2-69069PEP) (0)

There are no reviews for MYO15A Recombinant Protein Antigen (NBP2-69069PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MYO15A Recombinant Protein Antigen (NBP2-69069PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MYO15A Products

Array NBP2-69069PEP

Bioinformatics Tool for MYO15A Recombinant Protein Antigen (NBP2-69069PEP)

Discover related pathways, diseases and genes to MYO15A Recombinant Protein Antigen (NBP2-69069PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MYO15A Recombinant Protein Antigen (NBP2-69069PEP)

Discover more about diseases related to MYO15A Recombinant Protein Antigen (NBP2-69069PEP).
 

Pathways for MYO15A Recombinant Protein Antigen (NBP2-69069PEP)

View related products by pathway.

Blogs on MYO15A

There are no specific blogs for MYO15A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MYO15A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MYO15A