Recombinant Human MYLC2PL Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human MYLC2PL Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 226 of Human MYLC2PL full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MLLRLVSNSWPQVILPPRPPKVLGLQAPRRARKRAEGTASSNVFSMFDQSQIQEFKESLALSPRLERNGMISAHCNLCLTGSSNSPASASQAFTIMDQNRDGFIDKEDLRDTFAALGRINVKNEELEAMVKEAPGPINFTVFLTMFGEKLKGTDPEETILHAFKVFDTEGKGFVKADVIKEKLMTQADRFSEEEVKQMFAAFPPDVCGNLDYRNLCYVITHGEEKD

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
MYL10
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
51.7 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MYLC2PL Protein

  • MYLC2PLMGC3479
  • Myosin light chain 2, lymphocyte-specific
  • myosin regulatory light chain 10
  • myosin, light chain 10, regulatory
  • PLRLCmyosin light chain 2, precursor lymphocyte-specific
  • Precursor lymphocyte-specific regulatory light chain

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB2038
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP2-24695
Species: Hu
Applications: WB, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF6465
Species: Hu, Rt
Applications: WB, ICC
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-47489
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3634
Species: Mu
Applications: WB
H00093408-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for MYLC2PL Recombinant Protein (H00093408-P01) (0)

There are no publications for MYLC2PL Recombinant Protein (H00093408-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MYLC2PL Recombinant Protein (H00093408-P01) (0)

There are no reviews for MYLC2PL Recombinant Protein (H00093408-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MYLC2PL Recombinant Protein (H00093408-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MYLC2PL Products

Bioinformatics Tool for MYLC2PL Recombinant Protein (H00093408-P01)

Discover related pathways, diseases and genes to MYLC2PL Recombinant Protein (H00093408-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on MYLC2PL

There are no specific blogs for MYLC2PL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-7 [Unconjugated]
207-IL-005/CF
MYLC2PL RNAi
H00093408-R01-20nmol

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MYLC2PL Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MYL10