Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (4B5)

Images

 
Sandwich ELISA: Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (4B5) [H00001129-M01] - Detection limit for recombinant GST tagged CHRM2 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4B5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (4B5) Summary

Immunogen
CHRM2 (AAI06743.1, 251 a.a. - 350 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SDDGLEHNKIQNGKAPRDPVTENCVQGEEKESSNDSTSVSAVASNMRDDEITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKSDSCTPTNTTVEVVGSS
Specificity
CHRM2 - cholinergic receptor, muscarinic 2
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CHRM2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (4B5)

  • 7TM receptor
  • cholinergic receptor, muscarinic 2
  • CHRM2
  • FLJ43243
  • HM2
  • mAChR M2
  • MGC120006
  • MGC120007
  • muscarinic acetylcholine receptor M2
  • muscarinic M2 receptor

Background

The muscarinic cholinergic receptors belong to a larger family of G protein-coupled receptors. The functional diversity of these receptors is defined by the binding of acetylcholine to these receptors and includes cellular responses such as adenylate cyclase inhibition, phosphoinositide degeneration, and potassium channel mediation. Muscarinic receptors influence many effects of acetylcholine in the central and peripheral nervous system. The muscarinic cholinergic receptor 2 is involved in mediation of bradycardia and a decrease in cardiac contractility. Multiple alternatively spliced transcript variants have been described for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87466
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NBP1-87515
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-30052
Species: Hu, Mu, Rt, Av, Ch, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt
NB100-58978
Species: Hu, Mu, Rt, Po, Bt, Bv, Ca, Eq, Ha, Mk, Pm, Rb, Sh
Applications: ELISA, IHC-P
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP1-89489
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NLS418
Species: Hu
Applications: IHC-P
MAB8458
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP1-02658
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
H00441931-R02
Species: Hu
NBP1-84903
Species: Hu
Applications: WB, IHC, IHC-P
H00442206-R02
Species: Hu
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC

Publications for Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (H00001129-M01) (0)

There are no publications for Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (H00001129-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (H00001129-M01) (0)

There are no reviews for Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (H00001129-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (H00001129-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Muscarinic Acetylcholine Receptor M2/CHRM2 Products

Bioinformatics Tool for Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (H00001129-M01)

Discover related pathways, diseases and genes to Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (H00001129-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (H00001129-M01)

Discover more about diseases related to Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (H00001129-M01).
 

Pathways for Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (H00001129-M01)

View related products by pathway.

PTMs for Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (H00001129-M01)

Learn more about PTMs related to Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (H00001129-M01).
 

Research Areas for Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (H00001129-M01)

Find related products by research area.

Blogs on Muscarinic Acetylcholine Receptor M2/CHRM2

There are no specific blogs for Muscarinic Acetylcholine Receptor M2/CHRM2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (4B5) and receive a gift card or discount.

Bioinformatics

Gene Symbol CHRM2
Entrez
OMIM
Uniprot