MTUS2 Antibody


Immunohistochemistry-Paraffin: MTUS2 Antibody [NBP2-54923] - Immunohistochemical staining of human heart muscle shows moderate cytoplasmic positivity in myocytes.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

MTUS2 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KEIPSKLEAQLGQGKGEAKLDLKYVPPRRVEQEGKAAQEGYLGCHKEENLSALEGRDPCGEAHPEATDALGHLLNSDLHHLGVGRGNCEEKRGVNPGEQ
Specificity of human MTUS2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MTUS2 Recombinant Protein Antigen (NBP2-54923PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for MTUS2 Antibody

  • Cardiac zipper protein
  • CAZIPTracking protein of 150 kDa
  • KIAA0774+TIP of 150 kDa
  • microtubule associated tumor suppressor candidate 2
  • Microtubule plus-end tracking protein TIP150
  • TIP150microtubule-associated tumor suppressor candidate 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for MTUS2 Antibody (NBP2-54923) (0)

There are no publications for MTUS2 Antibody (NBP2-54923).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MTUS2 Antibody (NBP2-54923) (0)

There are no reviews for MTUS2 Antibody (NBP2-54923). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MTUS2 Antibody (NBP2-54923) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for MTUS2 Antibody (NBP2-54923)

Discover related pathways, diseases and genes to MTUS2 Antibody (NBP2-54923). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on MTUS2

There are no specific blogs for MTUS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MTUS2 Antibody and receive a gift card or discount.


Gene Symbol MTUS2