MTUS2 Antibody

Images

 
Western Blot: MTUS2 Antibody [NBP1-86604] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-361
Immunocytochemistry/ Immunofluorescence: MTUS2 Antibody [NBP1-86604] - Staining of human cell line HeLa shows localization to microtubules & cytokinetic bridge.
Immunohistochemistry-Paraffin: MTUS2 Antibody [NBP1-86604] - Staining of human heart muscle shows cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MTUS2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DSVLNIPAPLHPETTVNMTYQPTTPSSSFQDVSVFGMDAGSPLVVPPPTDSARLLNTSPKVPDKNTCPSGIPKPVFTHSKDTPSSQEGMENYQV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MTUS2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MTUS2 Protein (NBP1-86604PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MTUS2 Antibody

  • Cardiac zipper protein
  • CAZIPTracking protein of 150 kDa
  • KIAA0774+TIP of 150 kDa
  • microtubule associated tumor suppressor candidate 2
  • Microtubule plus-end tracking protein TIP150
  • TIP150microtubule-associated tumor suppressor candidate 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01064
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-84928
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00009167-B02P
Species: Hu
Applications: WB, ELISA
H00056899-P01
Species: Hu
NBP1-83936
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-00714
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for MTUS2 Antibody (NBP1-86604) (0)

There are no publications for MTUS2 Antibody (NBP1-86604).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MTUS2 Antibody (NBP1-86604) (0)

There are no reviews for MTUS2 Antibody (NBP1-86604). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MTUS2 Antibody (NBP1-86604) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MTUS2 Products

Bioinformatics Tool for MTUS2 Antibody (NBP1-86604)

Discover related pathways, diseases and genes to MTUS2 Antibody (NBP1-86604). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on MTUS2

There are no specific blogs for MTUS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MTUS2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MTUS2