Recombinant Human MTMR1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human MTMR1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 13881 of Human MTMR1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MLSLPAPLRVNRGLWQLCTGAGLWLLQGALPVTRSWAV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
MTMR1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MTMR1 Protein

  • EC 3.1.3
  • EC 3.1.3.-
  • EC 3.1.3.48
  • myotubularin related protein 1
  • myotubularin-related protein 1

Background

This gene encodes a member of the myotubularin related family of proteins. Members of this family contain the consensus sequence for the active site of protein tyrosine phosphatases. Alternatively spliced variants have been described but their biological validity has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86113
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-316
Species: Hu, Mu, Rt, Po, Bv, Pm, Rb
Applications: WB, Simple Western, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP
MAB6967
Species: Hu
Applications: WB
NBP2-16035
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56548
Species: Hu
Applications: ICC/IF
H00008897-M07
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-84530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-37256
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-97492
Species: Hu, Mu, Rt, Bv, Ca, Ch, Fi, GP, Ha, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-33580
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-85519
Species: Hu, Mu
Applications: WB, ELISA, IHC, IP
NBP1-69124
Species: Mu, Rt
Applications: WB, IHC
NBP2-42632
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
H00009107-T01
Species: Hu
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P
H00055613-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-13918
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MTMR1 Recombinant Protein (H00008776-P01) (0)

There are no publications for MTMR1 Recombinant Protein (H00008776-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MTMR1 Recombinant Protein (H00008776-P01) (0)

There are no reviews for MTMR1 Recombinant Protein (H00008776-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MTMR1 Recombinant Protein (H00008776-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MTMR1 Products

Bioinformatics Tool for MTMR1 Recombinant Protein (H00008776-P01)

Discover related pathways, diseases and genes to MTMR1 Recombinant Protein (H00008776-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MTMR1 Recombinant Protein (H00008776-P01)

Discover more about diseases related to MTMR1 Recombinant Protein (H00008776-P01).
 

Pathways for MTMR1 Recombinant Protein (H00008776-P01)

View related products by pathway.

PTMs for MTMR1 Recombinant Protein (H00008776-P01)

Learn more about PTMs related to MTMR1 Recombinant Protein (H00008776-P01).

Blogs on MTMR1

There are no specific blogs for MTMR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MTMR1 Antibody
NBP1-86042

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MTMR1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MTMR1