![Western Blot: MT-ND4 Antibody [NBP3-10134] - Western blot analysis of MT-ND4 in Mouse Lung lysates. Antibody dilution at 1ug/ml](http://images.novusbio.com/fullsize/MT-ND4-Antibody-Western-Blot-NBP3-10134-img0001.jpg "Western Blot: MT-ND4 Antibody [NBP3-10134] - Western blot analysis of MT-ND4 in Mouse Lung lysates. Antibody dilution at 1ug/ml")
| Description | Novus Biologicals Rabbit MT-ND4 Antibody - BSA Free (NBP3-10134) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle terminal region of mouse MTMT-ND4 (NP_904337.1). Peptide sequence MIRISIILDPLTKYMAYPFILLSLWGMIMTSSICLRQTDLKSLIAYSSVS |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ND4 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 52 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for MT-ND4 Antibody (NBP3-10134)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ND4 |
![Norrin/NDP Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Norrin/NDP Antibody [Unconjugated]")
