MS4A14 Antibody

Images

 
Western Blot: MS4A14 Antibody [NBP1-59621] - PANC1 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MS4A14 Antibody Summary

Immunogen
Synthetic peptides corresponding to NYD-SP21 The peptide sequence was selected from the middle region of NYD-SP21. Peptide sequence QYPEGQSKDGQVKDQQTDKEQNSKKQTQDQQTEDQPAQEKKSPKGQFQNV. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MS4A14
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against NYD-SP21 and was validated on Western blot.
Theoretical MW
76 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MS4A14 Antibody

  • DKFZp434H092
  • FLJ32856
  • membrane-spanning 4-domains subfamily A member 14
  • membrane-spanning 4-domains, subfamily A, member 14
  • membrane-spanning 4-domains, subfamily A, member 16
  • MGC104289
  • MGC49828
  • MS4A13 protein
  • MS4A13
  • MS4A16
  • NYD-SP21
  • testes development-related NYD-SP21
  • Testis development protein NYD-SP21

Background

NYD-SP21 may be involved in signal transduction as a component of a multimeric receptor complex.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBL1-12421
Species: Hu
NBP2-61118
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP2-31807
Species: Hu
Applications: IHC, IHC-P
NB100-74539
Species: Hu, Mu
Applications: WB, IHC, IHC-P, ICC, IF
NBP2-67741
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-20119
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB120-10109
Species: Hu
Applications: WB, Flow, IHC, IHC-P, S-ELISA, CyTOF-ready

Publications for MS4A14 Antibody (NBP1-59621) (0)

There are no publications for MS4A14 Antibody (NBP1-59621).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MS4A14 Antibody (NBP1-59621) (0)

There are no reviews for MS4A14 Antibody (NBP1-59621). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MS4A14 Antibody (NBP1-59621) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MS4A14 Products

Array NBP1-59621

Bioinformatics Tool for MS4A14 Antibody (NBP1-59621)

Discover related pathways, diseases and genes to MS4A14 Antibody (NBP1-59621). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MS4A14 Antibody (NBP1-59621)

Discover more about diseases related to MS4A14 Antibody (NBP1-59621).
 

Pathways for MS4A14 Antibody (NBP1-59621)

View related products by pathway.

Blogs on MS4A14

There are no specific blogs for MS4A14, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MS4A14 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MS4A14
Uniprot