MRPL42 Antibody - Azide and BSA Free

Western Blot: MRPL42 Antibody [H00028977-B01P] - Analysis of MRPL42 expression in transfected 293T cell line by MRPL42 polyclonal antibody. Lane 1: MRPL42 transfected lysate(15.62 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

MRPL42 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse MRPL42 Antibody - Azide and BSA Free (H00028977-B01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: MRPL42 (NP_054769.1, 1 a.a. - 142 a.a.) full-length human protein. MAVAAVKWVMSKRTILKHLFPVQNGALYCVCHKSTYSPLPDDYNCNVELALTSDGRTIVCYHPSVDIPYEHTKPIPRPDPVHNNEETHDQVLKTRLEEKVEHLEEGPMIEQLSKMFFTTKHRWYPHGRYHRCRKNLNPPKDR
• Specificity: MRPL42,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: MRPL42
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: This antibody is useful for ELISA and Western Blot.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MRPL42 Antibody - Azide and BSA Free

• 39S ribosomal protein L31, mitochondrial
• 39S ribosomal protein L42, mitochondrial
• HSPC204,28S ribosomal protein S32, mitochondrial
• L31mt
• mitochondrial ribosomal protein L42
• mitochondrial ribosomal protein S32
• MRPL31L42mt
• MRP-L31MRP-S32
• MRPS32MRP-L42
• PTD007
• RPML31S32mt

Background

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a protein identified as belonging to both the 28S and the 39S subunits. Further experiments will be needed to identify the specific subunit localization. Sequence analysis identified three transcript variants that encode two different isoforms. Pseudogenes corresponding to this gene are found on chromosomes 4q, 6p, 6q, 7p, and 15q. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MRPL42
• Entrez:
  • 28977(Human)
• Uniprot:
  • NP_054769.1(Human)