MRPL37 Antibody - BSA Free

Western Blot: MRPL37 Antibody [NBP1-82622] - Analysis using Anti-MRPL37 antibody NBP1-82622 (A) shows similar pattern to independent antibody NBP1-82621 (B).

Immunohistochemistry-Paraffin: MRPL37 Antibody [NBP1-82622] - Staining of human pancreas shows weak granular cytoplasmic positivity in exocrine glandular cells.

Immunohistochemistry-Paraffin: MRPL37 Antibody [NBP1-82622] - Staining of human rectum shows high expression.

Immunohistochemistry-Paraffin: MRPL37 Antibody [NBP1-82622] - Staining of human endometrium shows weak cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: MRPL37 Antibody [NBP1-82622] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MRPL37 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MRPL37 Antibody - BSA Free (NBP1-82622) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TDGRVFHFLVFQLNTTDLDSNEGVKNLAWVDSDQLLYQHFWCLPVIKKRVVVEPVGPVGFKPETFRKFLALYLHGA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MRPL37
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  MRPL37 Protein (NBP1-82622PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (86%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MRPL37 Antibody - BSA Free

• 39S ribosomal protein L2, mitochondrial
• L2mt
• L37mt
• MGC878
• mitochondrial ribosomal protein L37
• MRP-L2MRPL2
• MRP-L37
• ribosomal protein, mitochondrial, L2
• RPML239S ribosomal protein L37, mitochondrial

Background

MRPL37, also known as 39 S ribosomal protein L37, mitochondrial, is a 48.1 kDa, 423 amino acid protein that is involved in protein synthesis in the mitochondria as a member of the ribosomal protein S30/L37 family. There is no current research being conducted with this protein. The protein interacts with TK1, ICT1, SMN1, SMN2, and HNRNPA1 in protein synthesis pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MRPL37