MRPL37 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MRPL37 Antibody [NBP1-81032] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: MRPL37 Antibody [NBP1-81032] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MRPL37 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LTKTKLIEGLPEKVLSLVDDPRNHIENQDECVLNVISHARLWQTTEEIPKRETYCPVIVDNLIQLCKSQILKHP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MRPL37
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MRPL37 Protein (NBP1-81032PEP)
Publications
Read Publication using NBP1-81032.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (81%). Reactivity reported in scientific literature (PMID: 23227862)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MRPL37 Antibody

  • 39S ribosomal protein L2, mitochondrial
  • L2mt
  • L37mt
  • MGC878
  • mitochondrial ribosomal protein L37
  • MRP-L2MRPL2
  • MRP-L37
  • ribosomal protein, mitochondrial, L2
  • RPML239S ribosomal protein L37, mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87343
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-80653
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-05957
Species: Hu
H00002027-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13623
Species: Hu
Applications: IHC, IHC-P
H00006218-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP1-81032
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for MRPL37 Antibody (NBP1-81032)(1)

Reviews for MRPL37 Antibody (NBP1-81032) (0)

There are no reviews for MRPL37 Antibody (NBP1-81032). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MRPL37 Antibody (NBP1-81032) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MRPL37 Products

Bioinformatics Tool for MRPL37 Antibody (NBP1-81032)

Discover related pathways, diseases and genes to MRPL37 Antibody (NBP1-81032). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MRPL37 Antibody (NBP1-81032)

Discover more about diseases related to MRPL37 Antibody (NBP1-81032).
 

Pathways for MRPL37 Antibody (NBP1-81032)

View related products by pathway.

Research Areas for MRPL37 Antibody (NBP1-81032)

Find related products by research area.

Blogs on MRPL37

There are no specific blogs for MRPL37, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MRPL37 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MRPL37