MRPL37 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: MRPL37 Antibody [NBP1-81032] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: MRPL37 Antibody [NBP1-81032] - Staining of human kidney shows weak to moderate granular cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: MRPL37 Antibody [NBP1-81032] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: MRPL37 Antibody [NBP1-81032] - Staining of human stomach shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: MRPL37 Antibody [NBP1-81032] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MRPL37 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LTKTKLIEGLPEKVLSLVDDPRNHIENQDECVLNVISHARLWQTTEEIPKRETYCPVIVDNLIQLCKSQILKHP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MRPL37
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MRPL37 Protein (NBP1-81032PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (81%). Reactivity reported in scientific literature (PMID: 23227862)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MRPL37 Antibody - BSA Free

• 39S ribosomal protein L2, mitochondrial
• L2mt
• L37mt
• MGC878
• mitochondrial ribosomal protein L37
• MRP-L2MRPL2
• MRP-L37
• ribosomal protein, mitochondrial, L2
• RPML239S ribosomal protein L37, mitochondrial

Background

MRPL37, also known as 39 S ribosomal protein L37, mitochondrial, is a 48.1 kDa, 423 amino acid protein that is involved in protein synthesis in the mitochondria as a member of the ribosomal protein S30/L37 family. There is no current research being conducted with this protein. The protein interacts with TK1, ICT1, SMN1, SMN2, and HNRNPA1 in protein synthesis pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MRPL37 Antibody (NBP1-81032)(1)

Publication using NBP1-81032

• Danielsson F, Wiking M, Mahdessian D et al. RNA deep sequencing as a tool for selection of cell lines for systematic subcellular localization of all human proteins. J Proteome Res 2013-01-04 [PMID: 23227862]

Bioinformatics

• Gene Symbol: MRPL37
• Entrez:
  • 51253(Human)
• Uniprot:
  • Q9BZE1(Human)