![Western Blot: MPZL3 Antibody [NBP2-84169] - WB Suggested Anti-MPZL3 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Brain](http://images.novusbio.com/fullsize2/MPZL3 Antibody-Western Blot-NBP2-84169-img0001.jpg "Western Blot: MPZL3 Antibody [NBP2-84169] - WB Suggested Anti-MPZL3 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Brain")
| Reactivity | Hu, Rt, Po, Bv, CaSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of MPZL3. Peptide sequence: ALLLVRMGRKAAGLKKRSRSGYKKSSIEVSDDTDQEEEEACMARLCVRCA The peptide sequence for this immunogen was taken from within the described region. |
| Predicted Species | Rat (93%), Porcine (93%), Bovine (93%), Canine (93%). Backed by our 100% Guarantee. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MPZL3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Diseases for MPZL3 Antibody (NBP2-84169)Discover more about diseases related to MPZL3 Antibody (NBP2-84169).
| Pathways for MPZL3 Antibody (NBP2-84169)View related products by pathway.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MPZL3 |
![Immunocytochemistry/Immunofluorescence: Myelin Protein Zero Antibody [NB100-1607] - Immunohistochemical staining of P-zero on a 4.0% paraformaldehyde-fixed, paraffin-embedded tissue section through the sciatic nerve of an adult mouse. (Green) P0 concentration was 1:1000 dilution, followed by fluorescein-labeled goat anti-chicken IgY (1:500 dilution). Red is actin. Blue is DAPI nuclear counterstain.](http://images.novusbio.com/images2/Myelin-Protein-Zero-Antibody-Immunocytochemistry-Immunofluorescence-NB100-1607-img0001.jpg)
![Immunohistochemistry: Myelin Protein Zero Antibody [NB100-1607] - In the image (a lower power tissue section through an adult sciatic nerve), Myelin Protein Zero (brown staining) can be seen in all of the myelinating Schwann cells.](http://images.novusbio.com/images2/Myelin-Protein-Zero-Antibody-Immunohistochemistry-NB100-1607-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: EVA1/MPZL2 Antibody [NBP2-31836] - Staining of human cell line RT4 shows localization to cell junctions.](http://images.novusbio.com/images2/EVA1-MPZL2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-31836-img0008.jpg)
![Immunohistochemistry: EVA1/MPZL2 Antibody [NBP2-31836] - Staining of liver cancer.](http://images.novusbio.com/images2/EVA1-MPZL2-Antibody-Immunohistochemistry-NBP2-31836-img0006.jpg)
![Immunohistochemistry-Paraffin: EVA1/MPZL2 Antibody [NBP2-31836] - Staining of human esophagus shows moderate cytoplasmic positivity in squamous epithelial cells.](http://images.novusbio.com/images2/EVA1-MPZL2-Antibody-Immunohistochemistry-Paraffin-NBP2-31836-img0007.jpg)
![Western Blot: Regucalcin Antibody [NBP1-80849] - Analysis using Anti-RGN antibody NBP1-80849 (A) shows similar pattern to independent antibody NBP1-80850 (B).](http://images.novusbio.com/images2/Regucalcin-Antibody-Western-Blot-NBP1-80849-img0019.jpg)
![Immunohistochemistry-Paraffin: Regucalcin Antibody [NBP1-80849] - Staining of human kidney.](http://images.novusbio.com/images2/Regucalcin-Antibody-Immunohistochemistry-Paraffin-NBP1-80849-img0022.jpg)
![Western Blot: Regucalcin Antibody [NBP1-80849] - Lane 1: Mouse liver tissue lysate Lane 2: Rat liver tissue lysate. Recommended dilution: 1:250 - 1:500](http://images.novusbio.com/images2/Regucalcin-Antibody-Western-Blot-NBP1-80849-img0004.jpg)
![Western Blot: MTSS1 Antibody [NBP2-24716] - Analysis of MTSS1 in human testis lysate in the 1) absence and 2) presence of immunizing peptide, 3) mouse and 4) rat testis lysate using NBP2-24716 at 2 ug/ml, 4 ug/ml and 2 ug/ml, respectively.](http://images.novusbio.com/images2/MTSS1-Antibody-Western-Blot-NBP2-24716-img0005.jpg)
![Immunohistochemistry-Paraffin: MTSS1 Antibody [NBP2-24716] - Analysis of human colon using this antibody at 10 ug/ml.](http://images.novusbio.com/images2/MTSS1-Antibody-Immunohistochemistry-Paraffin-NBP2-24716-img0004.jpg)
![Immunocytochemistry/Immunofluorescence: HIVEP3 Antibody [NBP1-93993] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.](http://images.novusbio.com/images2/HIVEP3 Antibody-Immunocytochemistry-Immunofluorescence-NBP1-93993-img0006.jpg)
![Immunohistochemistry-Paraffin: HIVEP3 Antibody [NBP1-93993] - Staining of human rectum shows moderate nuclear and cytoplasmic positivity in glandular cells.](http://images.novusbio.com/images2/HIVEP3-Antibody-Immunohistochemistry-Paraffin-NBP1-93993-img0005.jpg)
